Active Recombinant Mouse Pspn Protein

• Cat.No.: Pspn-5209M
• Product Overview: Purified recombinant protein of Mouse persephin (Pspn) without tag was expressed in E. coli.

Specification

• Species: Mouse
• Source: E.coli
• Description: This gene encodes a secreted ligand of the GDNF (glial cell line-derived neurotrophic factor) subfamily and TGF-beta (transforming growth factor-beta) superfamily of proteins. The encoded preproprotein is proteolytically processed to generate the mature protein. This protein signals through the RET receptor tyrosine kinase and a GPI-linked coreceptor, and promotes survival of neuronal populations. This protein may play a role in cell death, and nervous system development and function. Mice lacking a functional copy of this gene exhibit hypersensitivity to cerebral ischemia.
• Bio-activity: ED50 was determined by its ability to stimulate proliferation of human thyroid carcinoma cells (TT cells) is > 0.1 ng/mL, corresponding to a specific activity of > 1 × 10^7 units/mg.
• Molecular Mass: 10.3 kDa
• AA Sequence: ALAGSCRLWSLTLPVAELGLGYASEEKVIFRYCAGSCPQEARTQHSLVLARLRGRGRAHGRPCCQPTSYADVTFLDDQHHWQQLPQLSAAACGCGG
• Endotoxin: < 0.1 ng/μg of protein (< 1 EU/μg)
• Purity: > 95% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for at least 6 months from date of receipt under proper storage and handling conditions.
• Storage: Store at -80 centigrade.
• Storage Buffer: LyopH ilized from a 0.2 μM filtered solution of 20 mM pH ospH ate buffer, 100 mM NaCl, pH 7.2

Gene Information

• Gene Name: Pspn persephin [ Mus musculus (house mouse) ]
• Official Symbol: Pspn
• Synonyms: PSPN; persephin; PSP
• Gene ID: 19197
• mRNA Refseq: NM_008954
• Protein Refseq: NP_032980
• UniProt ID: A1L3Q1