Recombinant Human PSME1 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | PSME1-752H |
Product Overview : | PSME1 MS Standard C13 and N15-labeled recombinant protein (NP_006254) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 20S core is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. The 19S regulator is composed of a base, which contains 6 ATPase subunits and 2 non-ATPase subunits, and a lid, which contains up to 10 non-ATPase subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. The immunoproteasome contains an alternate regulator, referred to as the 11S regulator or PA28, that replaces the 19S regulator. Three subunits (alpha, beta and gamma) of the 11S regulator have been identified. This gene encodes the alpha subunit of the 11S regulator, one of the two 11S subunits that is induced by gamma-interferon. Three alpha and three beta subunits combine to form a heterohexameric ring. Alternative splicing results in multiple transcript variants. |
Molecular Mass : | 28.7 kDa |
AA Sequence : | MAMLRVQPEAQAKVDVFREDLCTKTENLLGSYFPKKISELDAFLKEPALNEANLSNLKAPLDIPVPDPVKEKEKEERKKQQEKEDKDEKKKGEDEDKGPPCGPVNCNEKIVVLLQRLKPEIKDVIEQLNLVTTWLQLQIPRIEDGNNFGVAVQEKVFELMTSLHTKLEGFHTQISKYFSERGDAVTKAAKQPHVGDYRQLVHELDEAEYRDIRLMVMEIRNAYAVLYDIILKNFEKLKKPRGETKGMIYTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | PSME1 proteasome activator subunit 1 [ Homo sapiens (human) ] |
Official Symbol | PSME1 |
Synonyms | PSME1; proteasome (prosome, macropain) activator subunit 1 (PA28 alpha); proteasome activator complex subunit 1; IFI5111; PA28alpha; REG-alpha; IGUP I-5111; 29-kD MCP activator subunit; interferon-gamma IEF SSP 5111; proteasome activator subunit-1; 11S regulator complex alpha subunit; 11S regulator complex subunit alpha; proteasome activator 28 subunit alpha; interferon-gamma-inducible protein 5111; interferon gamma up-regulated I-5111 protein; activator of multicatalytic protease subunit 1; PA28A; REGalpha; MGC8628; |
Gene ID | 5720 |
mRNA Refseq | NM_006263 |
Protein Refseq | NP_006254 |
MIM | 600654 |
UniProt ID | Q06323 |
◆ Recombinant Proteins | ||
PSME1-361H | Recombinant Human PSME1, His tagged | +Inquiry |
PSME1-8952Z | Recombinant Zebrafish PSME1 | +Inquiry |
PSME1-752H | Recombinant Human PSME1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Psme1-5201M | Recombinant Mouse Psme1 Protein, Myc/DDK-tagged | +Inquiry |
PSME1-7227M | Recombinant Mouse PSME1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PSME1-2742HCL | Recombinant Human PSME1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PSME1 Products
Required fields are marked with *
My Review for All PSME1 Products
Required fields are marked with *
0
Inquiry Basket