Recombinant Human PSMC3

Cat.No. : PSMC3-31224TH
Product Overview : Recombinant fragment of Human PSMC3 with an N terminal proprietary tag; Predicted MWt 36.63 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 100 amino acids
Description : The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 20S core is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. The 19S regulator is composed of a base, which contains 6 ATPase subunits and 2 non-ATPase subunits, and a lid, which contains up to 10 non-ATPase subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes one of the ATPase subunits, a member of the triple-A family of ATPases that have chaperone-like activity. This subunit may compete with PSMC2 for binding to the HIV tat protein to regulate the interaction between the viral protein and the transcription complex. A pseudogene has been identified on chromosome 9.
Molecular Weight : 36.630kDa inclusive of tags
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MNLLPNIESPVTRQEKMATVWDEAEQDGIGEEVLKMSTEEIIQRTRLLDSEIKIMKSEVLRVTHELQAMKDKIKENSEKIKVNKTLPYLVSNVIELLDVD
Sequence Similarities : Belongs to the AAA ATPase family.
Gene Name PSMC3 proteasome (prosome, macropain) 26S subunit, ATPase, 3 [ Homo sapiens ]
Official Symbol PSMC3
Synonyms PSMC3; proteasome (prosome, macropain) 26S subunit, ATPase, 3; 26S protease regulatory subunit 6A; TBP 1; TBP1;
Gene ID 5702
mRNA Refseq NM_002804
Protein Refseq NP_002795
MIM 186852
Uniprot ID P17980
Chromosome Location 11p11.2
Pathway APC/C-mediated degradation of cell cycle proteins, organism-specific biosystem; APC/C:Cdc20 mediated degradation of Securin, organism-specific biosystem; APC/C:Cdc20 mediated degradation of mitotic proteins, organism-specific biosystem; APC/C:Cdh1 mediated degradation of Cdc20 and other APC/C:Cdh1 targeted proteins in late mitosis/early G1, organism-specific biosystem; Activation of APC/C and APC/C:Cdc20 mediated degradation of mitotic proteins, organism-specific biosystem;
Function ATP binding; hydrolase activity; nucleoside-triphosphatase activity; nucleotide binding; protein binding;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All PSMC3 Products

Required fields are marked with *

My Review for All PSMC3 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon