Recombinant Human PSMB8 protein(181-270 aa), C-His-tagged

• Cat.No.: PSMB8-2708H
• Product Overview: Recombinant Human PSMB8 protein(P28062)(181-270 aa), fused with C-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• ProteinLength: 181-270 aa
• Form: 0.15 M Phosphate buffered saline
• AASequence: PGLYYVDEHGTRLSGNMFSTGSGNTYAYGVMDSGYRPNLSPEEAYDLGRRAIAYATHRDSYSGGVVNMYHMKEDGWVKVESTDVSDLLHQ
• Storage: Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
  Up to 12 months when aliquoted and stored at -20 to -80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.

Gene Information

• Gene Name: PSMB8 proteasome (prosome, macropain) subunit, beta type, 8 (large multifunctional peptidase 7) [ Homo sapiens ]
• Official Symbol: PSMB8
• Synonyms: PSMB8; proteasome (prosome, macropain) subunit, beta type, 8 (large multifunctional peptidase 7); LMP7, proteasome (prosome, macropain) subunit, beta type, 8 (large multifunctional protease 7); proteasome subunit beta type-8; beta5i; D6S216E; PSMB5i; RING10; macropain subunit C13; proteasome subunit Y2; protease component C13; proteasome component C13; proteasome-related gene 7; proteasome subunit beta 5i; low molecular mass protein 7; low molecular weight protein 7; proteasome catalytic subunit 3i; really interesting new gene 10 protein; multicatalytic endopeptidase complex subunit C13; JMP; ALDD; LMP7; NKJO; D6S216; MGC1491
• Gene ID: 5696
• mRNA Refseq: NM_004159
• Protein Refseq: NP_004150
• MIM: 177046
• UniProt ID: P28062