Recombinant Human PSMB8 protein, His-SUMO & Myc-tagged

• Cat.No.: PSMB8-3382H
• Product Overview: Recombinant Human PSMB8 protein(P28062)(73-276aa), fused to N-terminal His-SUMO tag and C-terminal Myc tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His&Myc&SUMO
• ProteinLength: 73-276aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 42.7 kDa
• AA Sequence: TTTLAFKFQHGVIAAVDSRASAGSYISALRVNKVIEINPYLLGTMSGCAADCQYWERLLAKECRLYYLRNGERISVSAASKLLSNMMCQYRGMGLSMGSMICGWDKKGPGLYYVDEHGTRLSGNMFSTGSGNTYAYGVMDSGYRPNLSPEEAYDLGRRAIAYATHRDSYSGGVVNMYHMKEDGWVKVESTDVSDLLHQYREANQ
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: PSMB8 proteasome (prosome, macropain) subunit, beta type, 8 (large multifunctional peptidase 7) [ Homo sapiens ]
• Official Symbol: PSMB8
• Synonyms: PSMB8; proteasome (prosome, macropain) subunit, beta type, 8 (large multifunctional peptidase 7); LMP7, proteasome (prosome, macropain) subunit, beta type, 8 (large multifunctional protease 7); proteasome subunit beta type-8; beta5i; D6S216E; PSMB5i; RING10; macropain subunit C13; proteasome subunit Y2; protease component C13; proteasome component C13; proteasome-related gene 7; proteasome subunit beta 5i; low molecular mass protein 7; low molecular weight protein 7; proteasome catalytic subunit 3i; really interesting new gene 10 protein; multicatalytic endopeptidase complex subunit C13; JMP; ALDD; LMP7; NKJO; D6S216; MGC1491
• Gene ID: 5696
• mRNA Refseq: NM_004159
• Protein Refseq: NP_004150
• MIM: 177046
• UniProt ID: P28062