Recombinant Human PSMB3 protein, GST-tagged

• Cat.No.: PSMB3-3381H
• Product Overview: Recombinant Human PSMB3 protein(P49720)(1-205aa), fused to N-terminal GST tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: GST
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 49.8 kDa
• Protein length: 1-205aa
• AA Sequence: SIMSYNGGAVMAMKGKNCVAIAADRRFGIQAQMVTTDFQKIFPMGDRLYIGLAGLATDVQTVAQRLKFRLNLYELKEGRQIKPYTLMSMVANLLYEKRFGPYYTEPVIAGLDPKTFKPFICSLDLIGCPMVTDDFVVSGTCAEQMYGMCESLWEPNMDPDHLFETISQAMLNAVDRDAVSGMGVIVHIIEKDKITTRTLKARMD
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: PSMB3 proteasome (prosome, macropain) subunit, beta type, 3 [ Homo sapiens ]
• Official Symbol: PSMB3
• Synonyms: PSMB3; proteasome (prosome, macropain) subunit, beta type, 3; proteasome subunit beta type-3; HC10 II; MGC4147; proteasome chain 13; proteasome theta chain; proteasome component C10-II; HC10-II
• Gene ID: 5691
• mRNA Refseq: NM_002795
• Protein Refseq: NP_002786
• MIM: 602176
• UniProt ID: P49720