Recombinant Human PSG9
Cat.No. : | PSG9-30346TH |
Product Overview : | Recombinant full length mature Human PSG9 protein with an N terminal proprietary tag; Predicted MW 69.23 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
ProteinLength : | 392 amino acids |
Description : | The human pregnancy-specific glycoproteins (PSGs) are a group of molecules that are mainly produced by the placental syncytiotrophoblasts during pregnancy. PSGs comprise a subgroup of the carcinoembryonic antigen (CEA) family, which belongs to the immunoglobulin superfamily. For additional general information about the PSG gene family, see PSG1 (MIM 176390). |
Molecular Weight : | 69.230kDa inclusive of tags |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | EVTIEAQPPKVSEGKDVLLLVHNLPQNLPGYFWYKGEMTD LYHYIISYIVDGKIIIYGPAYSGRETVYSNASLLIQNVTR KDAGTYTLHIIKRGDETREEIRHFTFTLYLETPKPYISSS NLNPREAMEAVRLICDPETLDASYLWWMNGQSLPVTHRLQ LSKTNRTLYLFGVTKYIAGPYECEIRNPVSASRSDPVTLN LLPKLPIPYITINNLNPRENKDVLAFTCEPKSENYTYIWW LNGQSLPVSPGVKRPIENRILILPSVTRNETGPYQCEIQD RYGGLRSNPVILNVLYGPDLPRIYPSFTYYRSGENLDLSC FTESNPPAEYFWTINGKFQQSGQKLFIPQITRNHSGLYAC SVHNSATGKEISKSMTVKVSGPCHGDLTESQS |
Sequence Similarities : | Belongs to the immunoglobulin superfamily. CEA family.Contains 3 Ig-like C2-type (immunoglobulin-like) domains.Contains 1 Ig-like V-type (immunoglobulin-like) domain. |
Gene Name | PSG9 pregnancy specific beta-1-glycoprotein 9 [ Homo sapiens ] |
Official Symbol | PSG9 |
Synonyms | PSG9; pregnancy specific beta-1-glycoprotein 9; PSG11; pregnancy-specific beta-1-glycoprotein 9; PSGII; |
Gene ID | 5678 |
mRNA Refseq | NM_002784 |
Protein Refseq | NP_002775 |
MIM | 176398 |
Uniprot ID | Q00887 |
Chromosome Location | 19q13.2 |
◆ Recombinant Proteins | ||
FDX1-4207C | Recombinant Chicken FDX1 | +Inquiry |
CSF1-32H | Active Recombinant Human CSF1, His-tagged | +Inquiry |
RFL36511DF | Recombinant Full Length Dictyostelium Discoideum Pxmp2/4 Family Protein 3(Ddb_G0290223) Protein, His-Tagged | +Inquiry |
RANBP2-2250H | Recombinant Human RANBP2 Protein (2601-2802 aa), His-tagged | +Inquiry |
ODF3L1-6318M | Recombinant Mouse ODF3L1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
FGB-46P | Native Porcine Fibrinogen, FITC Labeled | +Inquiry |
HBsAg-01 | Native Hepatitis B Surface Ag protein | +Inquiry |
Acid phosphatase-158 | Active Native Wheat Germ Acid phosphatase Protein | +Inquiry |
Vtn-694M | Native Mouse Vitronectin | +Inquiry |
LDH-35C | Active Native Chicken Lactate dehydrogenase | +Inquiry |
◆ Cell & Tissue Lysates | ||
BCL6-8479HCL | Recombinant Human BCL6 293 Cell Lysate | +Inquiry |
XPNPEP3-260HCL | Recombinant Human XPNPEP3 293 Cell Lysate | +Inquiry |
AGXT-8967HCL | Recombinant Human AGXT 293 Cell Lysate | +Inquiry |
TRAP1-811HCL | Recombinant Human TRAP1 293 Cell Lysate | +Inquiry |
MAST4-1009HCL | Recombinant Human MAST4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PSG9 Products
Required fields are marked with *
My Review for All PSG9 Products
Required fields are marked with *
0
Inquiry Basket