Recombinant Human PSENEN Full Length Transmembrane protein, His-tagged

• Cat.No.: PSENEN-2467H
• Product Overview: Recombinant Human PSENEN protein(Q9NZ42)(1-101aa), fused to N-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 1-101aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 14.8 kDa
• AA Sequence: MNLERVSNEEKLNLCRKYYLGGFAFLPFLWLVNIFWFFREAFLVPAYTEQSQIKGYVWRSAVGFLFWVIVLTSWITIFQIYRPRWGALGDYLSFTIPLGTP
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: PSENEN presenilin enhancer 2 homolog (C. elegans) [ Homo sapiens ]
• Official Symbol: PSENEN
• Synonyms: PSENEN; presenilin enhancer 2 homolog (C. elegans); gamma-secretase subunit PEN-2; PEN2; hematopoietic stem/progenitor cells protein MDS033; PEN-2; MDS033; MSTP064
• Gene ID: 55851
• mRNA Refseq: NM_172341
• Protein Refseq: NP_758844
• MIM: 607632
• UniProt ID: Q9NZ42