Recombinant Human PSAP protein, GST-tagged
Cat.No. : | PSAP-3377H |
Product Overview : | Recombinant Human PSAP protein(P07602)(311-391aa), fused to N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 311-391aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 36.1 kDa |
AA Sequence : | SDVYCEVCEFLVKEVTKLIDNNKTEKEILDAFDKMCSKLPKSLSEECQEVVDTYGSSILSILLEEVSPELVCSMLHLCSGT |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | PSAP prosaposin [ Homo sapiens ] |
Official Symbol | PSAP |
Synonyms | PSAP; prosaposin; GLBA, SAP1, sphingolipid activator protein 1; proactivator polypeptide; variant Gaucher disease and variant metachromatic leukodystrophy; sphingolipid activator protein-1; GLBA; SAP1; FLJ00245; MGC110993; |
Gene ID | 5660 |
mRNA Refseq | NM_001042465 |
Protein Refseq | NP_001035930 |
MIM | 176801 |
UniProt ID | P07602 |
◆ Recombinant Proteins | ||
PSAP-3377H | Recombinant Human PSAP protein, GST-tagged | +Inquiry |
PSAP-9387Z | Recombinant Zebrafish PSAP | +Inquiry |
PSAP-30347TH | Recombinant Human PSAP, His-tagged | +Inquiry |
PSAP-20H | Recombinant Human PSAP protein, His-tagged | +Inquiry |
Psap-1125R | Recombinant Rat Psap protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PSAP-2792HCL | Recombinant Human PSAP 293 Cell Lysate | +Inquiry |
PSAP-2793HCL | Recombinant Human PSAP 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PSAP Products
Required fields are marked with *
My Review for All PSAP Products
Required fields are marked with *
0
Inquiry Basket