Recombinant Human PSAP protein, GST-tagged
Cat.No. : | PSAP-257H |
Product Overview : | Recombinant Human PSAP(1 a.a. - 524 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Protein Length : | 1-524 a.a. |
Description : | This gene encodes a highly conserved glycoprotein which is a precursor for 4 cleavage products: saposins A, B, C, and D. Each domain of the precursor protein is approximately 80 amino acid residues long with nearly identical placement of cysteine residues and glycosylation sites. Saposins A-D localize primarily to the lysosomal compartment where they facilitate the catabolism of glycosphingolipids with short oligosaccharide groups. The precursor protein exists both as a secretory protein and as an integral membrane protein and has neurotrophic activities. Mutations in this gene have been associated with Gaucher disease, Tay-Sachs disease, and metachromatic leukodystrophy. Alternative splicing results in multiple transcript variants encoding different isoforms. |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 83.16 kDa |
AA Sequence : | MYALFLLASLLGAALAGPVLGLKECTRGSAVWCQNVKTASDCGAVKHCLQTVWNKPTVKSLPCDICKDVVTAAGD MLKDNATEEEILVYLEKTCDWLPKPNMSASCKEIVDSYLPVILDIIKGEMSRPGEVCSALNLCESLQKHLAELNH QKQLESNKIPELDITEVVAPFMANIPLLLYPQDGPRSKPQPKDNGDVCQDCIQMVTDIQTAVRTNSTFVQALVEH VKEECDRLGPGMADICKNYISQYSEIAIQMMMHMQPKEICALVGFCDEVKEMPMQTLVPAKVASKNVIPALELVE PIKKHEVPAKSDVYCEVCEFLVKEVTKLIDNNKTEKEILDAFDKMCSKLPKSLSEECQEVVDTYGSSILSILLEE VSPELVCSMLHLCSGTRLPALTVHVTQPKDGGFCEVCKKLVGYLDRNLEKNSTKQEILAALEKGCSFLPDPYQKQ CDQFVAEYEPVLIEILVEVMDPSFVCLKIGACPLAHKPLLGTEKCIWGPSYWCQNTETAAQCNAVEHCKRHVWN |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade Aliquot to avoid repeated freezing and thawing. |
Gene Name | PSAP prosaposin [ Homo sapiens ] |
Official Symbol | PSAP |
Synonyms | PSAP; prosaposin; GLBA, SAP1, sphingolipid activator protein 1; proactivator polypeptide; variant Gaucher disease and variant metachromatic leukodystrophy; sphingolipid activator protein-1; GLBA; SAP1; FLJ00245; MGC110993; |
Gene ID | 5660 |
mRNA Refseq | NM_002778 |
Protein Refseq | NP_002769 |
MIM | 176801 |
UniProt ID | P07602 |
Chromosome Location | 10q21-q22 |
Pathway | Glycosphingolipid metabolism, organism-specific biosystem; Hemostasis, organism-specific biosystem; Lysosome, organism-specific biosystem; Lysosome, conserved biosystem; Metabolism, organism-specific biosystem; Metabolism of lipids and lipoproteins, organism-specific biosystem; Platelet activation, signaling and aggregation, organism-specific biosystem; |
Function | enzyme activator activity; lipid binding; |
◆ Recombinant Proteins | ||
PSAP-614HF | Recombinant Full Length Human PSAP Protein, GST-tagged | +Inquiry |
PSAP-13538M | Recombinant Mouse PSAP Protein | +Inquiry |
PSAP-20H | Recombinant Human PSAP protein, His-tagged | +Inquiry |
PSAP-4415R | Recombinant Rat PSAP Protein, His (Fc)-Avi-tagged | +Inquiry |
PSAP-6374C | Recombinant Chicken PSAP | +Inquiry |
◆ Cell & Tissue Lysates | ||
PSAP-2793HCL | Recombinant Human PSAP 293 Cell Lysate | +Inquiry |
PSAP-2792HCL | Recombinant Human PSAP 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PSAP Products
Required fields are marked with *
My Review for All PSAP Products
Required fields are marked with *
0
Inquiry Basket