Recombinant Human PSAP protein, GST-tagged
Cat.No. : | PSAP-18H |
Product Overview : | Recombinant Human PSAP(196 - 274 aa) fused with GST tag at N-terminal was expressed in E. coli. |
Availability | March 10, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 196-274 a.a. |
Description : | This gene encodes a highly conserved glycoprotein which is a precursor for 4 cleavage products: saposins A, B, C, and D. Each domain of the precursor protein is approximately 80 amino acid residues long with nearly identical placement of cysteine residues and glycosylation sites. Saposins A-D localize primarily to the lysosomal compartment where they facilitate the catabolism of glycosphingolipids with short oligosaccharide groups. The precursor protein exists both as a secretory protein and as an integral membrane protein and has neurotrophic activities. Mutations in this gene have been associated with Gaucher disease, Tay-Sachs disease, and metachromatic leukodystrophy. Alternative splicing results in multiple transcript variants encoding different isoforms. |
Form : | Protein lyophilized in sterile PBS (58 mM Na2HPO4, 17 mM NaH2PO4, 68 mM NaCl, 100 mM GSH, pH 8.0). Trehalose (5-8%) and mannitol (5-8%) protectants were added before lyophilization. |
Molecular Mass : | 35 kDa |
AA Sequence : | DVCQDCIQMVTDIQTAVRTNSTFVQALVEHVKEECDRLGPGMADICKNYISQYSEIAIQMMMHMQPKEICALVGF CDEV |
Purity : | > 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20 centigradeto -80 centigradeas lyophilized powder. |
Storage : | Short-term storage: Store at 2-8 centigradefor two weeks.Long-term storage: Aliquot and store at -20 centigradeto -80 centigradefor up to 6 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage (see Stability and Storage for more details).If a different concentration is needed for your purposes please adjust the reconstitution volume as required (please note: the ion concentration of the final solution will vary according to the volume used).Note: Centrifuge vial before opening. When reconstituting, gently pipet and wash down the sides of the vial to ensure full recovery of the protein into solution. |
Gene Name | PSAP prosaposin [ Homo sapiens ] |
Official Symbol | PSAP |
Synonyms | PSAP; prosaposin; GLBA, SAP1, sphingolipid activator protein 1; proactivator polypeptide; variant Gaucher disease and variant metachromatic leukodystrophy; sphingolipid activator protein-1; GLBA; SAP1; FLJ00245; MGC110993; |
Gene ID | 5660 |
mRNA Refseq | NM_002778 |
Protein Refseq | NP_002769 |
MIM | 176801 |
UniProt ID | P07602 |
Chromosome Location | 10q21-q22 |
Pathway | Glycosphingolipid metabolism, organism-specific biosystem; Hemostasis, organism-specific biosystem; Lysosome, organism-specific biosystem; Lysosome, conserved biosystem; Metabolism, organism-specific biosystem; Metabolism of lipids and lipoproteins, organism-specific biosystem; Platelet activation, signaling and aggregation, organism-specific biosystem; |
Function | enzyme activator activity; lipid binding; |
◆ Recombinant Proteins | ||
PSAP-5504H | Recombinant Human PSAP protein, His-tagged | +Inquiry |
Psap-1013M | Recombinant Mouse Psap Protein, His-tagged | +Inquiry |
PSAP-611HF | Recombinant Full Length Human PSAP Protein, GST-tagged | +Inquiry |
PSAP-7843H | Recombinant Human PSAP protein, GST-tagged | +Inquiry |
PSAP-30347TH | Recombinant Human PSAP, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PSAP-2792HCL | Recombinant Human PSAP 293 Cell Lysate | +Inquiry |
PSAP-2793HCL | Recombinant Human PSAP 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PSAP Products
Required fields are marked with *
My Review for All PSAP Products
Required fields are marked with *
0
Inquiry Basket