Recombinant Human PRTN3 protein, GST-tagged

• Cat.No.: PRTN3-301563H
• Product Overview: Recombinant Human PRTN3 (189-150 aa) protein, fused to GST tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: GST
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• Protein length: Asn89-Thr150
• AA Sequence: NVRTQEPTQQHFSVAQVFLNNYDAENKLNDVLLIQLSSPANLSASVATVQLPQQDQPVPHGT
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Stability: Store for up to 12 months at -20°C to -80°C as lyophilized powder.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.

Gene Information

• Gene Name: PRTN3 proteinase 3 [ Homo sapiens ]
• Official Symbol: PRTN3
• Synonyms: PRTN3; proteinase 3; myeloblastin; ACPA; AGP7; C ANCA; MBT; P29; PR 3; serine proteinase; neutrophil; Wegener granulomatosis autoantigen; NP-4; C-ANCA antigen; wegener autoantigen; leukocyte proteinase 3; neutrophil proteinase 4; azurophil granule protein 7; serine proteinase, neutrophil; MBN; NP4; PR3; PR-3; CANCA; C-ANCA
• Gene ID: 5657
• mRNA Refseq: NM_002777
• Protein Refseq: NP_002768
• MIM: 177020
• UniProt ID: P24158