Recombinant Human PRTFDC1, His-tagged

• Cat.No.: PRTFDC1-30710TH
• Product Overview: Recombinant full length Human PRTFDC1 with N terminal His tag; 248 amino acids with tag, Predicted MWt 28.1 kDa.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• ProteinLength: 225 amino acids
• Conjugation: HIS
• Molecular Weight: 28.100kDa inclusive of tags
• Form: Liquid
• Purity: >95% by SDS-PAGE
• Storage buffer: Preservative: NoneConstituents: 40% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0
• Storage: Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
• Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMGSMAGSSEEAPDYGRGVVIMDDWPGYDLNLFTYPQHYYGDLEYVLIPHGIIVDRIERLAKDIMKDIGYSDIMVLCVLKGGYKFCADLVEHLKNISRNSDRFVSMKVDFIRLKSYRNDQSMGEMQIIGGDDLSTLAGKNVLIVEDVVGTGRTMKALLSNIEKYKPNMIKVASLLVKRTSRSDGFRPDYAGFEIPNLFVVGYALDYNEYFRDLNHICVINEHGKEKYRV
• Sequence Similarities: Belongs to the purine/pyrimidine phosphoribosyltransferase family.

Gene Information

• Gene Name: PRTFDC1 phosphoribosyl transferase domain containing 1 [ Homo sapiens ]
• Official Symbol: PRTFDC1
• Synonyms: PRTFDC1; phosphoribosyl transferase domain containing 1; phosphoribosyltransferase domain-containing protein 1; HHGP
• Gene ID: 56952
• mRNA Refseq: NM_020200
• Protein Refseq: NP_064585
• MIM: 610751
• Uniprot ID: Q9NRG1
• Chromosome Location: 10p12.31
• Function: NOT hypoxanthine phosphoribosyltransferase activity; magnesium ion binding; magnesium ion binding; nucleotide binding; NOT phosphoglucomutase activity