Recombinant Human PRTFDC1, His-tagged

Cat.No. : PRTFDC1-30710TH
Product Overview : Recombinant full length Human PRTFDC1 with N terminal His tag; 248 amino acids with tag, Predicted MWt 28.1 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 225 amino acids
Conjugation : HIS
Molecular Weight : 28.100kDa inclusive of tags
Form : Liquid
Purity : >95% by SDS-PAGE
Storage buffer : Preservative: NoneConstituents: 40% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0
Storage : Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids : MGSSHHHHHHSSGLVPRGSHMGSMAGSSEEAPDYGRGVVIMDDWPGYDLNLFTYPQHYYGDLEYVLIPHGIIVDRIERLAKDIMKDIGYSDIMVLCVLKGGYKFCADLVEHLKNISRNSDRFVSMKVDFIRLKSYRNDQSMGEMQIIGGDDLSTLAGKNVLIVEDVVGTGRTMKALLSNIEKYKPNMIKVASLLVKRTSRSDGFRPDYAGFEIPNLFVVGYALDYNEYFRDLNHICVINEHGKEKYRV
Sequence Similarities : Belongs to the purine/pyrimidine phosphoribosyltransferase family.
Gene Name PRTFDC1 phosphoribosyl transferase domain containing 1 [ Homo sapiens ]
Official Symbol PRTFDC1
Synonyms PRTFDC1; phosphoribosyl transferase domain containing 1; phosphoribosyltransferase domain-containing protein 1; HHGP;
Gene ID 56952
mRNA Refseq NM_020200
Protein Refseq NP_064585
MIM 610751
Uniprot ID Q9NRG1
Chromosome Location 10p12.31
Function NOT hypoxanthine phosphoribosyltransferase activity; magnesium ion binding; magnesium ion binding; nucleotide binding; NOT phosphoglucomutase activity;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All PRTFDC1 Products

Required fields are marked with *

My Review for All PRTFDC1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon