Recombinant Human PRSS3 protein, His-tagged

• Cat.No.: PRSS3-3966H
• Product Overview: Recombinant Human PRSS3 protein(P35030)(81-303aa), fused to N-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 81-303aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 28.2 kDa
• AA Sequence: IVGGYTCEENSLPYQVSLNSGSHFCGGSLISEQWVVSAAHCYKTRIQVRLGEHNIKVLEGNEQFINAAKIIRHPKYNRDTLDNDIMLIKLSSPAVINARVSTISLPTTPPAAGTECLISGWGNTLSFGADYPDELKCLDAPVLTQAECKASYPGKITNSMFCVGFLEGGKDSCQRDSGGPVVCNGQLQGVVSWGHGCAWKNRPGVYTKVYNYVDWIKDTIAAN
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: PRSS3 protease, serine, 3 [ Homo sapiens ]
• Official Symbol: PRSS3
• Synonyms: PRSS3; protease, serine, 3; protease, serine, 3 (mesotrypsin) , protease, serine, 4 (trypsin 4, brain) , PRSS4; trypsin-3; mesotrypsin; TRY3; TRY4; trypsin IV; trypsin III; trypsinogen 4; trypsinogen 5; trypsinogen IV; mesotrypsinogen; brain trypsinogen; pancreatic trypsinogen III; protease, serine, 4 (trypsin 4, brain); T9; MTG; PRSS4
• Gene ID: 5646
• mRNA Refseq: NM_001197097
• Protein Refseq: NP_001184026
• MIM: 613578
• UniProt ID: P35030