Recombinant Human PRRX1 protein(11-80 aa), C-His-tagged

• Cat.No.: PRRX1-2787H
• Product Overview: Recombinant Human PRRX1 protein(P54821)(11-80 aa), fused with C-terminal His tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: His
• Protein length: 11-80 aa
• Form: 0.15 M Phosphate buffered saline
• AASequence: RQPALGGRLDSPGNLDTLQAKKNFSVSHLLDLEEAGDMVAAQADENVGEAGRSLLESPGLTSGSDTPQQD
• Storage: Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
  Up to 12 months when aliquoted and stored at -20 to -80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.

Gene Information

• Gene Name: PRRX1 paired related homeobox 1 [ Homo sapiens ]
• Official Symbol: PRRX1
• Synonyms: PRRX1; paired related homeobox 1; paired mesoderm homeo box 1 , PMX1; paired mesoderm homeobox protein 1; PHOX1; PRX-1; homeobox protein PHOX1; paired mesoderm homeo box 1; paired-related homeobox protein 1; paired mesoderm homeobox 1 isoform pmx-1b; PMX1; PRX1; AGOTC
• Gene ID: 5396
• mRNA Refseq: NM_006902
• Protein Refseq: NP_008833
• MIM: 167420
• UniProt ID: P54821