Recombinant Human PRRG1

• Cat.No.: PRRG1-30706TH
• Product Overview: Recombinant full length Human PRRG1 with a N terminal proprietary tag; Predicted MWt 51.90 kDa.

Specification

• Description: This gene encodes a vitamin K-dependent, gamma-carboxyglutamic acid (Gla)-containing, single-pass transmembrane protein. This protein contains a Gla domain at the N-terminus, preceded by a propeptide sequence required for post-translational gamma-carboxylation of specific glutamic acid residues by a vitamin K-dependent gamma-carboxylase. The C-terminus is proline-rich containing PPXY and PXXP motifs found in a variety of signaling and cytoskeletal proteins. This gene is highly expressed in the spinal cord. Several alternatively spliced transcript variants have been found for this gene.
• Protein length: 218 amino acids
• Molecular Weight: 51.900kDa inclusive of tags
• Source: Wheat germ
• Tissue specificity: Highly expressed in the spinal cord.
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: MGRVFLTGEKANSILKRYPRANGFFEEIRQGNIERECKEE FCTFEEAREAFENNEKTKEFWSTYTKAQQGESNRGSDWFQ FYLTFPLIFGLFIILLVIFLIWRCFLRNKTRRQTVTEGHI PFPQHLNIITPPPPPDEVFDSSGLSPGFLGYVVGRSDSVS TRLSNCDPPPTYEEATGQVNLQRSETEPHLDPPPEYEDIV NSNSASAIPMVPVVTTIK
• Sequence Similarities: Contains 1 Gla (gamma-carboxy-glutamate) domain.
• Tag: Non

Gene Information

• Gene Name: PRRG1 proline rich Gla (G-carboxyglutamic acid) 1 [ Homo sapiens ]
• Official Symbol: PRRG1
• Synonyms: PRRG1; proline rich Gla (G-carboxyglutamic acid) 1; proline rich Gla (G carboxyglutamic acid) polypeptide 1; transmembrane gamma-carboxyglutamic acid protein 1; PRGP1
• Gene ID: 5638
• mRNA Refseq: NM_000950
• Protein Refseq: NP_000941
• MIM: 604428
• Uniprot ID: O14668
• Chromosome Location: Xp21.1
• Function: calcium ion binding