Recombinant Human PRR4 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: PRR4-4255H
• Product Overview: PRR4 MS Standard C13 and N15-labeled recombinant protein (NP_009175) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: Myc&DDK
• Description: This gene encodes a member of the proline-rich protein family that lacks a conserved repetitive domain. This protein may play a role in protective functions in the eye. Alternative splicing result in multiple transcript variants. Read-through transcription also exists between this gene and the upstream PRH1 (proline-rich protein HaeIII subfamily 1) gene.
• Molecular Mass: 14.9 kDa
• AA Sequence: MLLVLLSVVLLALSSAQSTDNDVNYEDFTFTIPDVEDSSQRPDQGPQRPPPEGLLPRPPGDSGNQDDGPQQRPPKPGGHHRHPPPPPFQNQQRPPQRGHRQLSLPRFPSVSLQEASSFFRRDRPARHPQEQPLWTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: PRR4 proline rich 4 [ Homo sapiens (human) ]
• Official Symbol: PRR4
• Synonyms: PRR4; proline rich 4; LPRP; PROL4; proline-rich protein 4; lacrimal proline-rich protein; nasopharyngeal carcinoma-associated proline-rich protein 4; proline rich 4 (lacrimal); proline-rich polypeptide 4
• Gene ID: 11272
• mRNA Refseq: NM_007244
• Protein Refseq: NP_009175
• MIM: 605359
• UniProt ID: Q16378