Recombinant Human PRPH
Cat.No. : | PRPH-30643TH |
Product Overview : | Recombinant fragment corresponding to amino acids 374-470 of Human Peripherin with an N terminal proprietary tag; Predicted MWt 36.3 kDa inclusive of tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 97 amino acids |
Description : | This gene encodes a cytoskeletal protein found in neurons of the peripheral nervous system. The encoded protein is a type III intermediate filament protein with homology to other cytoskeletal proteins such as desmin, and is a different protein that the peripherin found in photoreceptors. Mutations in this gene have been associated with susceptibility to amyotrophic lateral sclerosis. |
Molecular Weight : | 36.300kDa inclusive of tags |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | RHLREYQELLNVKMALDIEIATYRKLLEGEESRISVPVHSFASLNIKTTVPEVEPPQDSHSRKTVLIKTIETRNGEVVTESQKEQRSELDKSSAHSY |
Sequence Similarities : | Belongs to the intermediate filament family. |
Gene Name | PRPH peripherin [ Homo sapiens ] |
Official Symbol | PRPH |
Synonyms | PRPH; peripherin; NEF4; PRPH1; |
Gene ID | 5630 |
mRNA Refseq | NM_006262 |
Protein Refseq | NP_006253 |
MIM | 170710 |
Uniprot ID | P41219 |
Chromosome Location | 12q12-q13 |
Pathway | Amyotrophic lateral sclerosis (ALS), organism-specific biosystem; Amyotrophic lateral sclerosis (ALS), conserved biosystem; |
Function | structural molecule activity; |
◆ Recombinant Proteins | ||
PRPH-01H | Recombinant Human PRPH Protein, His-tagged | +Inquiry |
PRPH-2627H | Recombinant Human PRPH Protein, His-tagged | +Inquiry |
PRPH-30642TH | Recombinant Human PRPH | +Inquiry |
Prph-5150M | Recombinant Mouse Prph Protein, Myc/DDK-tagged | +Inquiry |
PRPH-8682Z | Recombinant Zebrafish PRPH | +Inquiry |
◆ Cell & Tissue Lysates | ||
PRPH-2822HCL | Recombinant Human PRPH 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PRPH Products
Required fields are marked with *
My Review for All PRPH Products
Required fields are marked with *
0
Inquiry Basket