Recombinant Human Prostate Specific Gene-1

• Cat.No.: PG-54H
• Product Overview: Recombinant HPG-1 is a 16 kDa recombinant fusion protein consisting of 127 amino acid residues of the human HPG-1 and 9 additional amino acid residues of the His-Tag (underlined). MKHHHHHHHMIKKNLKKLGIEETYLNIIKAIYDRPTASIQKTENLSTKTGTSQEYHLSPLWFYIVLEILASTIRQEKNLKDIHTEKEEVK LSLFADAMILYLKKPNDSTR KLLELIKKIHSSCRIKINIH FAFCSQ

Specification

• Cat. No.: PG-54H
• Description: Human Prostate-Specific Gene-1 (HPG-1) product is a recently discovered membrane-anchored protein of approximately 15 kD. It was detected exclusively in the prostate (19 different tissues were tested). Antisense-oligonicleotide inhibition of HPG-1 expression inhibited the growth of one prostate cancer cell line (LNCaP) significantly (86%). HPG-1 might be a novel diagnostic and/or therapeutic target.
• Source: E.coli
• Purity: >95% (SDS-PAGE analyzed).
• Formulation: Sterile filtered and lyophilized from 0.5 mg/ml in 0.05 M MES buffer pH6.5
• Reconstitution: Add 0.2 ml of dH₂O and let the lyophilized pellet dissolve completely. For conversion into higher pH value, we recommend intensive dilution by relevant buffer to a concentration of 10μg/ml. In higher concentrations the solubility of this antigen is limited.
• Specificity: The amino acid sequence of the recombinant HPG-1 is 100% homologous to the amino acid sequence of the human HPG-1.
• Purification Method: Ni-NTA affinity chromatography
• Applications: Western blotting, ELISA
• Storage: Store lyophilized protein at -20°C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles. Reconstituted protein can be stored at 4°C for a limited period of time.

Gene Information

• Synonyms: HPG-1; Prostate Specific Gene-1; PG.