Recombinant Human Prostate Specific Gene-1
Cat.No. : | PG-54H |
Product Overview : | Recombinant HPG-1 is a 16 kDa recombinant fusion protein consisting of 127 amino acid residues of the human HPG-1 and 9 additional amino acid residues of the His-Tag (underlined). MKHHHHHHHMIKKNLKKLGIEETYLNIIKAIYDRPTASIQKTENLSTKTGTSQEYHLSPLWFYIVLEILASTIRQEKNLKDIHTEKEEVK LSLFADAMILYLKKPNDSTR KLLELIKKIHSSCRIKINIH FAFCSQ |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Description : | Human Prostate-Specific Gene-1 (HPG-1) product is a recently discovered membrane-anchored protein of approximately 15 kD. It was detected exclusively in the prostate (19 different tissues were tested). Antisense-oligonicleotide inhibition of HPG-1 expression inhibited the growth of one prostate cancer cell line (LNCaP) significantly (86%). HPG-1 might be a novel diagnostic and/or therapeutic target. |
Purity : | >95% (SDS-PAGE analyzed). |
Formulation : | Sterile filtered and lyophilized from 0.5 mg/ml in 0.05 M MES buffer pH6.5 |
Reconstitution : | Add 0.2 ml of dH2O and let the lyophilized pellet dissolve completely. For conversion into higher pH value, we recommend intensive dilution by relevant buffer to a concentration of 10μg/ml. In higher concentrations the solubility of this antigen is limited. |
Specificity : | The amino acid sequence of the recombinant HPG-1 is 100% homologous to the amino acid sequence of the human HPG-1. |
Purification Method : | Ni-NTA affinity chromatography |
Applications : | Western blotting, ELISA |
Storage : | Store lyophilized protein at -20°C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles. Reconstituted protein can be stored at 4°C for a limited period of time. |
Synonyms | HPG-1; Prostate Specific Gene-1; PG. |
◆ Recombinant Proteins | ||
PG-54H | Recombinant Human Prostate Specific Gene-1 | +Inquiry |
PG-4566H | Recombinant Hinoki false-cypress PG protein, His-SUMO-tagged | +Inquiry |
PG-5794C | Recombinant Chamaecyparis obtusa PG protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PG Products
Required fields are marked with *
My Review for All PG Products
Required fields are marked with *
0
Inquiry Basket