Recombinant human Proinsulin HIP 11, His-tagged
| Cat.No. : | HIP11-01H |
| Product Overview : | Recombinant human Proinsulin HIP 11, fused to His tag, was expressed in E. coli. |
| Availability | February 08, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Form : | PBS buffer, pH 7.4 |
| Molecular Mass : | ~13.35 kDa |
| AA Sequence : | MFVNQHLCGSHLVEALYLVCGERGFFYTPKTRREAEDLQVGQVELGGGPGAGSLQPLALEAEDLQVGQVELGGGPGAGSLQPLALEGSLQEGSLQKRGIVEQCCTSICSLYQLENYCNHHHHHH |
| Purity : | >90 % as determined by SDS-PAGE |
| Storage : | Long Term Storage at -20°C to -80°C. Avoid freeze/thaw cycles. |
| Concentration : | 0.3 ug/ul |
| ◆ Native Proteins | ||
| CLU-67H | Native Human Clusterin | +Inquiry |
| FSH-1566P | Active Native Porcine Stimulating Hormone | +Inquiry |
| Hemocyanin-031H | Native Helix pomatia Hemocyanin Protein | +Inquiry |
| PT-141B | Native Bordetella pertussis Perrtussis toxin | +Inquiry |
| MMP9-9810 | Active Native Human MMP9 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ASRGL1-140HCL | Recombinant Human ASRGL1 cell lysate | +Inquiry |
| ACLY-509HCL | Recombinant Human ACLY cell lysate | +Inquiry |
| IL6R-2903HCL | Recombinant Human IL6R cell lysate | +Inquiry |
| CLCF1-001HCL | Recombinant Human CLCF1 cell lysate | +Inquiry |
| TBC1D19-1227HCL | Recombinant Human TBC1D19 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HIP11 Products
Required fields are marked with *
My Review for All HIP11 Products
Required fields are marked with *
0
Inquiry Basket
