Recombinant human Proinsulin HIP 11, His-tagged
Cat.No. : | HIP11-01H |
Product Overview : | Recombinant human Proinsulin HIP 11, fused to His tag, was expressed in E. coli. |
Availability | April 26, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Form : | PBS buffer, pH 7.4 |
Molecular Mass : | ~13.35 kDa |
AA Sequence : | MFVNQHLCGSHLVEALYLVCGERGFFYTPKTRREAEDLQVGQVELGGGPGAGSLQPLALEAEDLQVGQVELGGGPGAGSLQPLALEGSLQEGSLQKRGIVEQCCTSICSLYQLENYCNHHHHHH |
Purity : | >90 % as determined by SDS-PAGE |
Storage : | Long Term Storage at -20°C to -80°C. Avoid freeze/thaw cycles. |
Concentration : | 0.3 ug/ul |
◆ Recombinant Proteins | ||
HIP11-01H | Recombinant human Proinsulin HIP 11, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HIP11 Products
Required fields are marked with *
My Review for All HIP11 Products
Required fields are marked with *
0
Inquiry Basket