Recombinant Human Pro-Nerve Growth Factor

• Cat.No.: NGF-11H
• Product Overview: Pro NGF is the pro-form of the neurotrophin nerve growth factor. Like the mature protein pro NGF is characterized by the cysteine knot motif consisting of three cysteine bridges. The protein predominantly exists as a non-covalently linked homodimer. Pro-Nerve Growth Factor Human Recombinant produced in E.Coli is a non-glycosylated, polypeptide chain containing 222 amino acids and having a molecular mass of 49,738 Dalton. The Pro NGF is purified by proprietary chromatographic techniques.

Specification

• Species: Human
• Source: E.coli
• Tag: Non
• Physical Appearance: Sterile Filtered clear solution.
• Amino acid sequence: MEPHSESNVPAGHTIPQVHWTKLQHSLDTALRRARSAPAAAIAARVAGQTRNITVDPRLFKK RRLRSPRVLFSTQPPREAADTQDLDFEVGGAAPFNRTHRSKRSSSHPIFHRGEFSVCDSV SVWVGDKTTATDIKGKEVMVLGEVNINNSVFKQYFFETKCRDPNPVDSGCRGIDSKHWNS YCTTTHTFVKALTMDGKQAAWRFIRIDTACVCVLSRKAR.
• Purity: Greater than 98.0% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
• Formulation: The sterile protein solution 1.2mg/ml contains 50mM sodium phosphate buffer pH 7.2. 150mM sodium chloride.
• Biological Activity: The activity of the protein can by measured by its stimulating effect on the proliferation of TF1 cells (Chevalier et al. 1994 Blood 83, 1479-85). EC50 130 ± 30 pM (TF1 cell assay).
• Storage: Pro-Nerve Growth Factor although stable at 15℃ for a week, should be stored at -20℃. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles.

Gene Information

• Synonyms: Human Pro-NGF; ProNGF; Pro-Nerve Growth Factor.