Recombinant Human PRMT8 Protein, GST-tagged

• Cat.No.: PRMT8-5043H
• Product Overview: Human HRMT1L4 partial ORF ( NP_062828, 235 a.a. - 334 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: Arginine methylation is a widespread posttranslational modification mediated by arginine methyltransferases, such as PRMT8. Arginine methylation is involved in a number of cellular processes, including DNA repair, RNA transcription, signal transduction, protein compartmentalization, and possibly protein translation (Lee et al., 2005 [PubMed 16051612]).[supplied by OMIM
• Molecular Mass: 36.74 kDa
• AA Sequence: CLQIQRNDYVHALVTYFNIEFTKCHKKMGFSTAPDAPYTHWKQTVFYLEDYLTVRRGEEIYGTISMKPNAKNVRDLDFTVDLDFKGQLCETSVSNDYKMR
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: PRMT8 protein arginine methyltransferase 8 [ Homo sapiens ]
• Official Symbol: PRMT8
• Synonyms: PRMT8; protein arginine methyltransferase 8; HMT1 hnRNP methyltransferase like 3 (S. cerevisiae) , HMT1 hnRNP methyltransferase like 4 (S. cerevisiae) , HRMT1L3, HRMT1L4; protein arginine N-methyltransferase 8; HMT1 hnRNP methyltransferase-like 3; protein arginine N-methyltransferase 4; heterogeneous nuclear ribonucleoprotein methyltransferase-like protein 4; HRMT1L3; HRMT1L4
• Gene ID: 56341
• mRNA Refseq: NM_001256536
• Protein Refseq: NP_001243465
• MIM: 610086
• UniProt ID: Q9NR22