Recombinant Human PRMT2 Protein, transcript variant 1, C-Flag-tagged
Cat.No. : | PRMT2-02H |
Product Overview : | Recombinant Human PRMT2 Protein, transcript variant 1, fused to Flag-tag at C-terminus, was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | Flag |
Description : | Enables several functions, including nuclear receptor binding activity; peroxisome proliferator activated receptor binding activity; and protein homodimerization activity. Involved in several processes, including histone methylation; regulation of androgen receptor signaling pathway; and regulation of transcription, DNA-templated. Located in cytosol and nucleoplasm. |
Form : | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol. |
Molecular Mass : | 48.9 kDa |
AA Sequence : | MATSGDCPRSESQGEEPAECSEAGLLQEGVQPEEFVAIADYAATDETQLSFLRGEKILILRQTTADWWWGERAGCCGYIPANHVGKHVDEYDPEDTWQDEEYFGSYGTLKLHLEMLADQPRTTKYHSVILQNKESLTDKVILDVGCGTGIISLFCAHYARPRAVYAVEASEMAQHTGQLVLQNGFADIITVYQQKVEDVVLPEKVDVLVSEWMGTCLLFEFMIESILYARDAWLKEDGVIWPTMAALHLVPCSADKDYRSKVLFWDNAYEFNLSALKSLAVKEFFSKPKYNHILKPEDCLSEPCTILQLDMRTVQISDLETLRGELRFDIRKAGTLHGFTAWFSVHFQSLQEGQPPQVLSTGPFHPTTHWKQTLFMMDDPVPVHTGDVVTGSVVLQRNPVWIRHMSVALSWAVTSRQDPTSQKVGEKVFPIWR SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Notes : | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage : | Store at -80 centigrade. |
Concentration : | >0.05 μg/μL as determined by microplate BCA method. |
Use/Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Gene Name | PRMT2 protein arginine methyltransferase 2 [ Homo sapiens (human) ] |
Official Symbol | PRMT2 |
Synonyms | HRMT1L1; protein arginine methyltransferase 2; NECTIN3 |
Gene ID | 3275 |
mRNA Refseq | NM_206962.4 |
Protein Refseq | NP_996845.1 |
MIM | 601961 |
UniProt ID | P55345 |
◆ Recombinant Proteins | ||
PRMT2-3431R | Recombinant Rhesus Macaque PRMT2 Protein, His (Fc)-Avi-tagged | +Inquiry |
PRMT2-3613R | Recombinant Rhesus monkey PRMT2 Protein, His-tagged | +Inquiry |
PRMT2-125H | Recombinant Human PRMT2 protein, GST-tagged | +Inquiry |
PRMT2-634HF | Recombinant Full Length Human PRMT2 Protein, GST-tagged | +Inquiry |
PRMT2-02H | Recombinant Human PRMT2 Protein, transcript variant 1, C-Flag-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PRMT2-2839HCL | Recombinant Human PRMT2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PRMT2 Products
Required fields are marked with *
My Review for All PRMT2 Products
Required fields are marked with *
0
Inquiry Basket