Recombinant Human PRMT2 Protein, transcript variant 1, C-Flag-tagged

• Cat.No.: PRMT2-02H
• Product Overview: Recombinant Human PRMT2 Protein, transcript variant 1, fused to Flag-tag at C-terminus, was expressed in HEK293.

Specification

• Description: Enables several functions, including nuclear receptor binding activity; peroxisome proliferator activated receptor binding activity; and protein homodimerization activity. Involved in several processes, including histone methylation; regulation of androgen receptor signaling pathway; and regulation of transcription, DNA-templated. Located in cytosol and nucleoplasm.
• Source: HEK293
• Species: Human
• Tag: Flag
• Form: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol.
• Molecular Mass: 48.9 kDa
• AA Sequence: MATSGDCPRSESQGEEPAECSEAGLLQEGVQPEEFVAIADYAATDETQLSFLRGEKILILRQTTADWWWGERAGCCGYIPANHVGKHVDEYDPEDTWQDEEYFGSYGTLKLHLEMLADQPRTTKYHSVILQNKESLTDKVILDVGCGTGIISLFCAHYARPRAVYAVEASEMAQHTGQLVLQNGFADIITVYQQKVEDVVLPEKVDVLVSEWMGTCLLFEFMIESILYARDAWLKEDGVIWPTMAALHLVPCSADKDYRSKVLFWDNAYEFNLSALKSLAVKEFFSKPKYNHILKPEDCLSEPCTILQLDMRTVQISDLETLRGELRFDIRKAGTLHGFTAWFSVHFQSLQEGQPPQVLSTGPFHPTTHWKQTLFMMDDPVPVHTGDVVTGSVVLQRNPVWIRHMSVALSWAVTSRQDPTSQKVGEKVFPIWR SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining.
• Notes: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80 centigrade.
• Concentration: >0.05 μg/μL as determined by microplate BCA method.
• Use/Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Gene Information

• Gene Name: PRMT2 protein arginine methyltransferase 2 [ Homo sapiens (human) ]
• Official Symbol: PRMT2
• Synonyms: HRMT1L1; protein arginine methyltransferase 2; NECTIN3
• Gene ID: 3275
• mRNA Refseq: NM_206962.4
• Protein Refseq: NP_996845.1
• MIM: 601961
• UniProt ID: P55345