Recombinant Human PRMT2 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | PRMT2-5188H |
Product Overview : | PRMT2 MS Standard C13 and N15-labeled recombinant protein (NP_001526) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | Arginine methyltransferase that methylates the guanidino nitrogens of arginyl residues in proteins such as STAT3, FBL, histone H4. Acts as a coactivator (with NCOA2) of the androgen receptor (AR)-mediated transactivation. Acts as a coactivator (with estrogen) of estrogen receptor (ER)-mediated transactivation. Enhances PGR, PPARG, RARA-mediated transactivation. May inhibit NF-kappa-B transcription and promote apoptosis. Represses E2F1 transcriptional activity (in a RB1-dependent manner). May be involved in growth regulation. |
Molecular Mass : | 48.9 kDa |
AA Sequence : | MATSGDCPRSESQGEEPAECSEAGLLQEGVQPEEFVAIADYAATDETQLSFLRGEKILILRQTTADWWWGERAGCCGYIPANHVGKHVDEYDPEDTWQDEEYFGSYGTLKLHLEMLADQPRTTKYHSVILQNKESLTDKVILDVGCGTGIISLFCAHYARPRAVYAVEASEMAQHTGQLVLQNGFADIITVYQQKVEDVVLPEKVDVLVSEWMGTCLLFEFMIESILYARDAWLKEDGVIWPTMAALHLVPCSADKDYRSKVLFWDNAYEFNLSALKSLAVKEFFSKPKYNHILKPEDCLSEPCTILQLDMRTVQISDLETLRGELRFDIRKAGTLHGFTAWFSVHFQSLQEGQPPQVLSTGPFHPTTHWKQTLFMMDDPVPVHTGDVVTGSVVLQRNPVWRRHMSVALSWAVTSRQDPTSQKVGEKVFPIWRSGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | PRMT2 protein arginine methyltransferase 2 [ Homo sapiens (human) ] |
Official Symbol | PRMT2 |
Synonyms | PRMT2; protein arginine methyltransferase 2; HMT1 (hnRNP methyltransferase, S. cerevisiae) like 1, HMT1 hnRNP methyltransferase like 1 (S. cerevisiae), HRMT1L1; protein arginine N-methyltransferase 2; MGC111373; PRMT2 beta; PRMT2 alpha; PRMT2 gamma; HMT1 hnRNP methyltransferase-like 1; histone-arginine N-methyltransferase PRMT2; HMT1 (hnRNP methyltransferase, S. cerevisiae)-like 1; HRMT1L1; |
Gene ID | 3275 |
mRNA Refseq | NM_001535 |
Protein Refseq | NP_001526 |
MIM | 601961 |
UniProt ID | P55345 |
◆ Recombinant Proteins | ||
Prmt2-1170M | Recombinant Mouse Prmt2 Protein, MYC/DDK-tagged | +Inquiry |
PRMT2-634HF | Recombinant Full Length Human PRMT2 Protein, GST-tagged | +Inquiry |
PRMT2-31115TH | Recombinant Human PRMT2, His-tagged | +Inquiry |
PRMT2-3613R | Recombinant Rhesus monkey PRMT2 Protein, His-tagged | +Inquiry |
PRMT2-3431R | Recombinant Rhesus Macaque PRMT2 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PRMT2-2839HCL | Recombinant Human PRMT2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PRMT2 Products
Required fields are marked with *
My Review for All PRMT2 Products
Required fields are marked with *
0
Inquiry Basket