Recombinant Human PRMT2, His-tagged

• Cat.No.: PRMT2-31115TH
• Product Overview: Recombinant fragment, corresponding to amino acids 286-433 of Human PRMT2 with an N terminal His tag. Predicted MWt: 18 kDa

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 286-433 a.a.
• Description: Protein arginine N-methyltransferase 2 is an enzyme that in humans is encoded by the PRMT2 gene.
• Conjugation: HIS
• Tissue specificity: Ubiquitous.
• Form: Lyophilised:Reconstitute with 102 μl aqua dest.
• Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
• Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: SKPKYNHILKPEDCLSEPCTILQLDMRTVQISDLETLRGE LRFDIRKAGTLHGFTAWFSVHFQSLQEGQPPQVLSTGP FHPTTHWKQTLFMMDDPVPVHTGDVVTGSVVLQRNPVW RRHMSVALSWAVTSRQDPTSQKVGEKVFPIWR
• Sequence Similarities: Belongs to the protein arginine N-methyltransferase family.Contains 1 SH3 domain.

Gene Information

• Gene Name: PRMT2 protein arginine methyltransferase 2 [ Homo sapiens ]
• Official Symbol: PRMT2
• Synonyms: PRMT2; protein arginine methyltransferase 2; HMT1 (hnRNP methyltransferase, S. cerevisiae) like 1 , HMT1 hnRNP methyltransferase like 1 (S. cerevisiae) , HRMT1L1; protein arginine N-methyltransferase 2; MGC111373
• Gene ID: 3275
• mRNA Refseq: NM_001242864
• Protein Refseq: NP_001229793
• MIM: 601961
• Uniprot ID: P55345
• Chromosome Location: 21q22.3
• Pathway: mRNA processing, organism-specific biosystem
• Function: androgen receptor binding; estrogen receptor binding; estrogen receptor binding; histone methyltransferase activity; histone-arginine N-methyltransferase activity