Recombinant Human PRLR protein, GST-tagged

• Cat.No.: PRLR-59H
• Product Overview: Recombinant Human PRLR(1 a.a. - 622 a.a.) fused with GST tag at N-terminal was expressed in NS0.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Protein Length: 1 a.a. - 622 a.a.
• Description: This gene encodes a receptor for the anterior pituitary hormone, prolactin, and belongs to the type I cytokine receptor family. Prolactin-dependent signaling occurs as the result of ligand-induced dimerization of the prolactin receptor. Several alternatively spliced transcript variants encoding different membrane-bound and soluble isoforms have been described for this gene, which may function to modulate the endocrine and autocrine effects of prolactin in normal tissue and cancer.
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 95.9 kDa
• AA Sequence: MKENVASATVFTLLLFLNTCLLNGQLPPGKPEIFKCRSPNKETFTCWWRPGTDGGLPTNYSLTYHREGETLMHEC PDYITGGPNSCHFGKQYTSMWRTYIMMVNATNQMGSSFSDELYVDVTYIVQPDPPLELAVEVKQPEDRKPYLWIK WSPPTLIDLKTGWFTLLYEIRLKPEKAAEWEIHFAGQQTEFKILSLHPGQKYLVQVRCKPDHGYWSAWSPATFIQ IPSDFTMNDTTVWISVAVLSAVICLIIVWAVALKGYSMVTCIFPPVPGPKIKGFDAHLLEKGKSEELLSALGCQD FPPTSDYEDLLVEYLEVDDSEDQHLMSVHSKEHPSQGMKPTYLDPDTDSGRGSCDSPSLLSEKCEEPQANPSTFY DPEVIEKPENPETTHTWDPQCISMEGKIPYFHAGGSKCSTWPLPQPSQHNPRSSYHNITDVCELAVGPAGAPATL LNEAGKDALKSSQTIKSREEGKATQQREVESFHSETDQDTPWLLPQEKTPFGSAKPLDYVEIHKVNKDGALSLLP KQRENSGKPKKPGTPENNKEYAKVSGVMDNNILVLVPDPHAKNVACFEESAKEAPPSLEQNQAEKALANFTATSS KCRLQLGGLDYLDPACFTHSFH
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.

Gene Information

• Gene Name: PRLR prolactin receptor [ Homo sapiens ]
• Official Symbol: PRLR
• Synonyms: PRLR; prolactin receptor; PRL-R; hPRL receptor; secreted prolactin binding protein; hPRLrI
• Gene ID: 5618
• mRNA Refseq: NM_000949
• Protein Refseq: NP_000940
• MIM: 176761
• UniProt ID: P16471
• Chromosome Location: 5p14-p13
• Pathway: Adipogenesis, organism-specific biosystem; Cytokine Signaling in Immune system, organism-specific biosystem; Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; ErbB4 signaling events, organism-specific biosystem; Growth hormone receptor signaling, organism-specific biosystem; Immune System, organism-specific biosystem
• Function: cytokine receptor activity; metal ion binding; ornithine decarboxylase activator activity; peptide hormone binding; prolactin receptor activity; protein homodimerization activity; receptor activity