Recombinant Human PRL, StrepII-tagged

• Cat.No.: PRL-261H
• Product Overview: Purified, full-length human recombinant PRL or Prolactin protein (amino acids 29-227, 199 a.a.) with StrepII tag, produced in human cells. Predicted molecular weight: 22.9 kDa. (Accession NP_000939.1; UniProt P01236)

Specification

• Species: Human
• Source: Human Cells
• Tag: Strep II
• Protein Length: 29-227, 199 a.a.
• Description: Prolactin is an anterior pituitary hormone. It is a growth regulator for many tissues, including cells of the immune system. It may also play a role in cell survival by suppressing apoptosis, and it is essential for lactation.
• Form: Lyophilized from sterile 0.2μm filtered solution in 0.3X PBS with 10% Trehalose (carrier-free).
• AA Sequence: MNIKGSPWKGSLLLLLVSNLLLCQSVAPLPICPGGAARCQVTLRDLFDRAVVLSHYIHNLSSEMFSEFDKRYTHGRGFITKAINSCHTSSLATPEDKE QAQQMNQKDFLSLIVSILRSWNEPLYHLVTEVRGMQEAPEAILSKAVEIEEQTKRLLEGMELIVSQVHPETKENEIYPVWSGLPSLQMADEESRLSAYYNLLHCLRR DSHKIDNYLKLLKCRIIHNNNC
• Endotoxin: <0.1 eu per ug protein by lal
• Purity: >95% pure by SDS-PAGE
• Storage: 12 months at -20°C as supplied; 1 month at 4°C after reconstitution. Avoid freeze/thaw cycles.
• Reconstitution: Centrifuge the vial prior to opening. Reconstitute in PBS to a concentration of 0.1 mg/ml.

Gene Information

• Gene Name: PRL prolactin [ Homo sapiens ]
• Official Symbol: PRL
• Synonyms: PRL; prolactin; decidual prolactin
• Gene ID: 5617
• mRNA Refseq: NM_000948
• Protein Refseq: NP_000939
• MIM: 176760
• UniProt ID: P01236
• Chromosome Location: 6p22.2-p21.3
• Pathway: Amyloids, organism-specific biosystem; Cytokine Signaling in Immune system, organism-specific biosystem; Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; Disease, organism-specific biosystem; ErbB4 signaling events, organism-specific biosystem; Glucocorticoid receptor regulatory network, organism-specific biosystem
• Function: hormone activity; prolactin receptor binding