Recombinant Human PRL Protein

• Cat.No.: PRL-065H
• Product Overview: Recombinant human PRL protein without tag was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Protein Length: 227
• Description: This gene encodes the anterior pituitary hormone prolactin. This secreted hormone is a growth regulator for many tissues, including cells of the immune system. It may also play a role in cell survival by suppressing apoptosis, and it is essential for lactation. Alternative splicing results in multiple transcript variants that encode the same protein.
• Form: lyophilized
• Molecular Mass: 23.007 kDa
• AA Sequence: MNIKGSPWKGSLLLLLVSNLLLCQSVAPLPICPGGAARCQVTLRDLFDRAVVLSHYIHNLSSEMFSEFDKRYTHGRGFITKAINSCHTSSLATPEDKEQAQQMNQKDFLSLIVSILRSWNEPLYHLVTEVRGMQEAPEAILSKAVEIEEQTKRLLEGMELIVSQVHPETKENEIYPVWSGLPSLQMADEESRLSAYYNLLHCLRRDSHKIDNYLKLLKCRIIHNNNC
• Purity: > 95%
• Applications: WB; ELISA; FACS; FC
• Stability: This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use.
• Storage: -18°C
• Concentration: 1 mg/mL
• Storage Buffer: Sodium-phosphate (pH 8). Sterile-filtered colorless solution (reconst).
• Reconstitution: Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance.

Gene Information

• Gene Name: PRL prolactin [ Homo sapiens (human) ]
• Official Symbol: PRL
• Synonyms: PRL; prolactin; decidual prolactin
• Gene ID: 5617
• mRNA Refseq: NM_000948
• Protein Refseq: NP_000939
• MIM: 176760
• UniProt ID: P01236