Recombinant Bovine Prolactin Protein, His-Tagged

• Cat.No.: PRL-298B
• Product Overview: Recombinant Bovine PRL Protein, His-Tagged was expressed in E.coli cell

Specification

• Species: Bovine
• Source: E.coli
• Tag: His
• Protein Length: 31-229 a.a.
• Description: Prolactin (PRL), also known as lactotropin, is a protein best known for its role in enabling mammals to produce milk. It is influential in over 300 separate processes in various vertebrates, including humans.[5] Prolactin is secreted from the pituitary gland in response to eating, mating, estrogen treatment, ovulation and nursing. It is secreted heavily in pulses in between these events.
• Molecular Mass: The protein has a calculated MW of 24 kDa.
• AA Sequence: MGSSHHHHHHTPVCPNGPGNCQVSLRDLFDRAVMVSHYIHDLSSEMFNEFDKRYAQGKGFITMALNSCHTSSLPTPEDKEQAQQTHHEVLMSLILGLLRSWNDPLYHLVTEVRGMKGAPDAILSRAIEIEEENKRLLEGMEMIFGQVIPGAKETEPYPVWSGLPSLQTKDEDARYSAFYNLLHCLRRDSSKIDTYLKLLNCRIIYNNNC
• Purity: ＞90% by SDS-PAGE
• Storage: Store it under sterile conditions at -20 to -80 ºC. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Concentration: 0.19 mg/ml
• Storage Buffer: 50mM Tris, 300mM NaCl, pH 8.0

Gene Information

• Gene Name: PRL prolactin [ Bos taurus (cattle) ]
• Official Symbol: PRL
• Synonyms: GHA1; Prol
• Gene ID: 280901
• mRNA Refseq: NM_173953.2
• Protein Refseq: NP_776378.2
• UniProt ID: P01239