Recombinant Human PRKRIR Protein (612-761 aa), His-SUMO-tagged

• Cat.No.: PRKRIR-740H
• Product Overview: Recombinant Human PRKRIR Protein (612-761 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Signal Transduction. Protein Description: Partial.

Specification

• Species: Human
• Source: E.coli
• Tag: His&SUMO
• ProteinLength: 612-761 aa
• Description: Upstream regulator of interferon-induced serine/threonine protein kinase R (PKR). May block the PKR-inhibitory function of P58IPK, resulting in restoration of kinase activity and suppression of cell growth.
• Form: Tris-based buffer, 50% glycerol
• Molecular Mass: 33.6 kDa
• AA Sequence: MGQLKFNTSEEHHADMYRSDLPNPDTLSAELHCWRIKWKHRGKDIELPSTIYEALHLPDIKFFPNVYALLKVLCILPVMKVENERYENGRKRLKAYLRNTLTDQRSSNLALLNINFDIKHDLDLMVDTYIKLYTSKSELPTDNSETVENT
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with concentration instruction is sent along with the products.

Gene Information

• Gene Name: PRKRIR protein-kinase, interferon-inducible double stranded RNA dependent inhibitor, repressor of (P58 repressor) [ Homo sapiens ]
• Official Symbol: PRKRIR
• Synonyms: PRKRIR; DAP4; P52rIPK; THAP0; MGC102750
• Gene ID: 5612
• mRNA Refseq: NM_004705
• Protein Refseq: NP_004696
• MIM: 607374
• UniProt ID: O43422