Recombinant Human PRKRIP1 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: PRKRIP1-3663H
• Product Overview: PRKRIP1 MS Standard C13 and N15-labeled recombinant protein (NP_078929) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: PRKRIP1 (PRKR Interacting Protein 1) is a Protein Coding gene. Diseases associated with PRKRIP1 include Fructose-1,6-Bisphosphatase Deficiency and Familial Febrile Seizures. Gene Ontology (GO) annotations related to this gene include protein kinase binding and protein kinase inhibitor activity.
• Molecular Mass: 21 kDa
• AA Sequence: MASPAASSVRPPRPKKEPQTLVIPKNAAEEQKLKLERLMKNPDKAVPIPEKMSEWAPRPPPEFVRDVMGSSAGAGSGEFHVYRHLRRREYQRQDYMDAMAEKQKLYAEFQKRLEKNKIAAEEQTAKRRKKRQKLKEKKLLAKKMKLEQKKQEGPGQPKEQGSSSSAEASGTEEEEEVPSFTMGRTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: PRKRIP1 PRKR interacting protein 1 [ Homo sapiens (human) ]
• Official Symbol: PRKRIP1
• Synonyms: PRKRIP1; PRKR interacting protein 1 (IL11 inducible); PRKR-interacting protein 1; C114; FLJ13902; KRAB box domain containing 3; KRBOX3; likely ortholog of mouse C114 dsRNA binding protein; likely ortholog of mouse C114 dsRNA-binding protein; FLJ40957
• Gene ID: 79706
• mRNA Refseq: NM_024653
• Protein Refseq: NP_078929
• MIM: 617458
• UniProt ID: Q9H875