Recombinant Human PRKAR2B protein, His-tagged

• Cat.No.: PRKAR2B-1953H
• Product Overview: Recombinant Human PRKAR2B protein(1-122 aa), fused with His tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: His
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
• Protein length: 1-122 aa
• AA Sequence: MSIEIPAGLTELLQGFTVEVLRHQPADLLEFALQHFTRLQQENERKGTARFCHEGRTWGDLGAAAGGGTPSKGVNFAEEPMQSDSEDGEEEEAAPADAGAFNAPVINRFTRRASVCAEAYNP
• Purity: 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: PRKAR2B protein kinase, cAMP-dependent, regulatory, type II, beta [ Homo sapiens ]
• Official Symbol: PRKAR2B
• Synonyms: PRKAR2B; protein kinase, cAMP-dependent, regulatory, type II, beta; PRKAR2; cAMP-dependent protein kinase type II-beta regulatory subunit; H_RG363E19.2; WUGSC:H_RG363E19.2; cAMP-dependent protein kinase type II-beta regulatory chain; RII-BETA
• Gene ID: 5577
• mRNA Refseq: NM_002736
• Protein Refseq: NP_002727
• MIM: 176912
• UniProt ID: P31323