Recombinant Human PRG4, GST-tagged

• Cat.No.: PRG4-1501H
• Product Overview: Recombinant Human PRG4 encoding (1305 a.a. - 1404 a.a.), fused a GST-tag at N-terminal, was expressed in Wheat germ.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: The protein encoded by this gene is a large proteoglycan specifically synthesized by chondrocytes located at the surface of articular cartilage, and also by some synovial lining cells. This protein contains both chondroitin sulfate and keratan sulfate glycosaminoglycans. It functions as a boundary lubricant at the cartilage surface and contributes to the elastic absorption and energy dissipation of synovial fluid. Mutations in this gene result in camptodactyly-arthropathy-coxa vara-pericarditis syndrome. Multiple transcript variants encoding different isoforms have been found for this gene.
• Molecular Mass: 36.74 kDa
• Purity: Glutathione Sepharose 4 Fast Flow
• Applications: WB
• Sequence: ERAIGPSQTHTIRIQYSPARLAYQDKGVLHNEVKVSILWRGLPNVVTSAISLPNIRKPDGYDYYAFSKDQYYNID VPSRTARAITTRSGQTLSKVWYNCP
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Storage: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
• Note: Best use within three months from the date of receipt of this protein.
• OfficialSymbol: PRG4

Gene Information

• Gene Name: PRG4 proteoglycan 4 [ Homo sapiens ]
• Synonyms: PRG4; proteoglycan 4; MSF; SZP; CACP; HAPO; JCAP; FLJ32635; bG174L6.2; lubricin; OTTHUMP00000033580; megakaryocyte stimulating factor; articular superficial zone protein; bG174L6.2 (MSF: megakaryocyte stimulating factor ); proteoglycan 4, (megakaryocyte stimulating factor, articular superficial zone protein, camptodactyly, arthropathy, coxa vara, pericarditis syndrome); Megakaryocyte-stimulating factor; Superficial zone proteoglycan; Proteoglycan 4 C-terminal part
• Gene ID: 10216
• mRNA Refseq: NM_005807
• Protein Refseq: NP_005798
• MIM: 604283
• UniProt ID: Q92954
• Chromosome Location: 1q25-q31
• Function: polysaccharide binding; protein binding; scavenger receptor activity