Recombinant Human PRDX2 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : PRDX2-6209H
Product Overview : PRDX2 MS Standard C13 and N15-labeled recombinant protein (NP_005800) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : This gene encodes a member of the peroxiredoxin family of antioxidant enzymes, which reduce hydrogen peroxide and alkyl hydroperoxides. The encoded protein plays an antioxidant protective role in cells, and it may contribute to the antiviral activity of CD8(+) T-cells. The crystal structure of this protein has been resolved to 2.7 angstroms. This protein prevents hemolytic anemia from oxidative stress by stabilizing hemoglobin, thus making this gene a therapeutic target for patients with hemolytic anemia. This protein may have a proliferative effect and play a role in cancer development or progression. Related pseudogenes have been identified on chromosomes 5, 6, 10 and 13.
Source : HEK293
Species : Human
Tag : Myc&DDK
Molecular Mass : 21.7 kDa
AA Sequence : MASGNARIGKPAPDFKATAVVDGAFKEVKLSDYKGKYVVLFFYPLDFTFVCPTEIIAFSNRAEDFRKLGCEVLGVSVDSQFTHLAWINTPRKEGGLGPLNIPLLADVTRRLSEDYGVLKTDEGIAYRGLFIIDGKGVLRQITVNDLPVGRSVDEALRLVQAFQYTDEHGEVCPAGWKPGSDTIKPNVDDSKEYFSKHNTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name PRDX2 peroxiredoxin 2 [ Homo sapiens (human) ]
Official Symbol PRDX2
Synonyms PRDX2; peroxiredoxin 2; TDPX1; peroxiredoxin-2; MGC4104; natural killer enhancing factor B; NKEFB; PRP; PRX2; PRXII; thiol specific antioxidant 1; thioredoxin peroxidase 1; thioredoxin dependent peroxide reductase 1; torin; TSA; NKEF-B; thiol-specific antioxidant 1; thiol-specific antioxidant protein; natural killer cell-enhancing factor B; thioredoxin-dependent peroxide reductase 1; TPX1;
Gene ID 7001
mRNA Refseq NM_005809
Protein Refseq NP_005800
MIM 600538
UniProt ID P32119

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All PRDX2 Products

Required fields are marked with *

My Review for All PRDX2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon