Recombinant Human PRC1 protein, GST-tagged

• Cat.No.: PRC1-528H
• Product Overview: Recombinant Human PRC1 protein(NP_003972)(13-175 aa), fused to GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 13-175 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.). 5 % trehalose and 5 % mannitol are added as protectants before lyophilization.
• AA Sequence: VCLQKALNHLREIWELIGIPEDQRLQRTEVVKKHIKELLDMMIAEEESLKERLIKSISVCQKELNTLCSELHVEPFQEEGETTILQLEKDLRTQVELMRKQKKERKQELKLLQEQDQELCEILCMPHYDIDSASVPSLEELNQFRQHVTTLRETKASRREEFV
• Purity: 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage (see Stability and Storage for more details).

Gene Information

• Gene Name: PRC1 protein regulator of cytokinesis 1 [ Homo sapiens ]
• Official Symbol: PRC1
• Synonyms: PRC1; protein regulator of cytokinesis 1; anaphase spindle elongation 1 homolog (S. cerevisiae); ASE1; protein regulating cytokinesis 1; anaphase spindle elongation 1 homolog; MGC1671; MGC3669
• Gene ID: 9055
• mRNA Refseq: NM_003981
• Protein Refseq: NP_003972
• MIM: 603484
• UniProt ID: O43663