Recombinant Human PPP3R2 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : PPP3R2-1848H
Product Overview : PPP3R2 MS Standard C13 and N15-labeled recombinant protein (NP_671709) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : Regulatory subunit of calcineurin, a calcium-dependent, calmodulin stimulated protein phosphatase. Confers calcium sensitivity.
Molecular Mass : 19.9 kDa
AA Sequence : MSTMGNEASYPAEMCSHFDNDEIKRLGRRFKKLDLDKSGSLSVEEFMSLPELRHNPLVRRVIDVFDTDGDGEVDFKEFILGTSQFSVKGDEEQKLRFAFSIYDMDKDGYISNGELFQVLKMMVGNNLTDWQLQQLVDKTIIILDKDGDGKISFEEFSAVVRDLEIHKKLVLIVTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name PPP3R2 protein phosphatase 3 regulatory subunit B, beta [ Homo sapiens (human) ]
Official Symbol PPP3R2
Synonyms PPP3R2; protein phosphatase 3, regulatory subunit B, beta; protein phosphatase 3 (formerly 2B), regulatory subunit B (19kD), beta isoform (calcineurin B, type II), protein phosphatase 3 (formerly 2B), regulatory subunit B, 19kDa, beta isoform (calcineurin B, type II), protein phosphatase 3 (formerly 2B), regulatory subunit B, beta isoform; calcineurin subunit B type 2; calcineurin B; type II (19kDa); PPP3RL; protein phosphatase 2B regulatory subunit 2; protein phosphatase 3; regulatory subunit B (calcineurin B) like; CBLP; CNBII; calcineurin BII; calcineurin B-like protein; calcineurin B, type II (19kDa); protein phosphatase 3 regulatory subunit B beta isoform; protein phosphatase 3 (formerly 2B), regulatory subunit B, beta isoform; protein phosphatase 3 (formerly 2B), regulatory subunit B (19kD), beta isoform (calcineurin B, type II); protein phosphatase 3 (formerly 2B), regulatory subunit B, 19kDa, beta isoform (calcineurin B, type II);
Gene ID 5535
mRNA Refseq NM_147180
Protein Refseq NP_671709
MIM 613821
UniProt ID Q96LZ3

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All PPP3R2 Products

Required fields are marked with *

My Review for All PPP3R2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon