Recombinant Human PPP3R2 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: PPP3R2-1848H
• Product Overview: PPP3R2 MS Standard C13 and N15-labeled recombinant protein (NP_671709) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: Regulatory subunit of calcineurin, a calcium-dependent, calmodulin stimulated protein phosphatase. Confers calcium sensitivity.
• Molecular Mass: 19.9 kDa
• AA Sequence: MSTMGNEASYPAEMCSHFDNDEIKRLGRRFKKLDLDKSGSLSVEEFMSLPELRHNPLVRRVIDVFDTDGDGEVDFKEFILGTSQFSVKGDEEQKLRFAFSIYDMDKDGYISNGELFQVLKMMVGNNLTDWQLQQLVDKTIIILDKDGDGKISFEEFSAVVRDLEIHKKLVLIVTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: PPP3R2 protein phosphatase 3 regulatory subunit B, beta [ Homo sapiens (human) ]
• Official Symbol: PPP3R2
• Synonyms: PPP3R2; protein phosphatase 3, regulatory subunit B, beta; protein phosphatase 3 (formerly 2B), regulatory subunit B (19kD), beta isoform (calcineurin B, type II), protein phosphatase 3 (formerly 2B), regulatory subunit B, 19kDa, beta isoform (calcineurin B, type II), protein phosphatase 3 (formerly 2B), regulatory subunit B, beta isoform; calcineurin subunit B type 2; calcineurin B; type II (19kDa); PPP3RL; protein phosphatase 2B regulatory subunit 2; protein phosphatase 3; regulatory subunit B (calcineurin B) like; CBLP; CNBII; calcineurin BII; calcineurin B-like protein; calcineurin B, type II (19kDa); protein phosphatase 3 regulatory subunit B beta isoform; protein phosphatase 3 (formerly 2B), regulatory subunit B, beta isoform; protein phosphatase 3 (formerly 2B), regulatory subunit B (19kD), beta isoform (calcineurin B, type II); protein phosphatase 3 (formerly 2B), regulatory subunit B, 19kDa, beta isoform (calcineurin B, type II)
• Gene ID: 5535
• mRNA Refseq: NM_147180
• Protein Refseq: NP_671709
• MIM: 613821
• UniProt ID: Q96LZ3