Recombinant Human PPP3R1, His-tagged

Cat.No. : PPP3R1-27208TH
Product Overview : Recombinant full length Human Calcineurin B with N terminal His tag; 190 amino acids with tag, MWt 21.5 kDa inclusive of tag,
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 170 amino acids
Description : PPP3R1, also known as Calcineurin subunit B type 1, is a Ser/Thr-specific calcium and calmodulin-dependent protein phosphatase that plays an essential role in the T cell activation pathway.
Conjugation : HIS
Molecular Weight : 21.500kDa inclusive of tags
Form : Liquid
Purity : >90% by SDS-PAGE
Storage buffer : Preservative: NoneConstituents: 10% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 2mM DTT, pH 8.0
Storage : Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids : MGSSHHHHHHSSGLVPRGSHMGNEASYPLEMCSHFDADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQQNPLVQRVIDIFDTDGNGEVDFKEFIEGVSQFSVKGDKEQKLRFAFRIYDMDKDGYISNGELFQVLKMMVGNNLKDTQLQQIVDKTIINADKDGDGRISFEEFCAVVGGLDIHKKMVVDV
Sequence Similarities : Belongs to the calcineurin regulatory subunit family.Contains 4 EF-hand domains.
Gene Name PPP3R1 protein phosphatase 3, regulatory subunit B, alpha [ Homo sapiens ]
Official Symbol PPP3R1
Synonyms PPP3R1; protein phosphatase 3, regulatory subunit B, alpha; protein phosphatase 3 (formerly 2B), regulatory subunit B (19kD), alpha isoform (calcineurin B, type I) , protein phosphatase 3 (formerly 2B), regulatory subunit B, 19kDa, alpha isoform (calcine
Gene ID 5534
mRNA Refseq NM_000945
Protein Refseq NP_000936
MIM 601302
Uniprot ID P63098
Chromosome Location 2p14
Pathway Activation of BAD and translocation to mitochondria, organism-specific biosystem; Activation of BH3-only proteins, organism-specific biosystem; Alzheimers disease, organism-specific biosystem; Alzheimers disease, conserved biosystem; Amyotrophic lateral sclerosis (ALS), organism-specific biosystem;
Function calcium ion binding; calcium-dependent protein serine/threonine phosphatase activity; calmodulin binding; phosphoprotein phosphatase activity;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All PPP3R1 Products

Required fields are marked with *

My Review for All PPP3R1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon