Recombinant Human PPP3R1, His-tagged
Cat.No. : | PPP3R1-27208TH |
Product Overview : | Recombinant full length Human Calcineurin B with N terminal His tag; 190 amino acids with tag, MWt 21.5 kDa inclusive of tag, |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 170 amino acids |
Description : | PPP3R1, also known as Calcineurin subunit B type 1, is a Ser/Thr-specific calcium and calmodulin-dependent protein phosphatase that plays an essential role in the T cell activation pathway. |
Conjugation : | HIS |
Molecular Weight : | 21.500kDa inclusive of tags |
Form : | Liquid |
Purity : | >90% by SDS-PAGE |
Storage buffer : | Preservative: NoneConstituents: 10% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 2mM DTT, pH 8.0 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMGNEASYPLEMCSHFDADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQQNPLVQRVIDIFDTDGNGEVDFKEFIEGVSQFSVKGDKEQKLRFAFRIYDMDKDGYISNGELFQVLKMMVGNNLKDTQLQQIVDKTIINADKDGDGRISFEEFCAVVGGLDIHKKMVVDV |
Sequence Similarities : | Belongs to the calcineurin regulatory subunit family.Contains 4 EF-hand domains. |
Gene Name | PPP3R1 protein phosphatase 3, regulatory subunit B, alpha [ Homo sapiens ] |
Official Symbol | PPP3R1 |
Synonyms | PPP3R1; protein phosphatase 3, regulatory subunit B, alpha; protein phosphatase 3 (formerly 2B), regulatory subunit B (19kD), alpha isoform (calcineurin B, type I) , protein phosphatase 3 (formerly 2B), regulatory subunit B, 19kDa, alpha isoform (calcine |
Gene ID | 5534 |
mRNA Refseq | NM_000945 |
Protein Refseq | NP_000936 |
MIM | 601302 |
Uniprot ID | P63098 |
Chromosome Location | 2p14 |
Pathway | Activation of BAD and translocation to mitochondria, organism-specific biosystem; Activation of BH3-only proteins, organism-specific biosystem; Alzheimers disease, organism-specific biosystem; Alzheimers disease, conserved biosystem; Amyotrophic lateral sclerosis (ALS), organism-specific biosystem; |
Function | calcium ion binding; calcium-dependent protein serine/threonine phosphatase activity; calmodulin binding; phosphoprotein phosphatase activity; |
◆ Recombinant Proteins | ||
PPP3R1-27208TH | Recombinant Human PPP3R1, His-tagged | +Inquiry |
PPP3R1-3471H | Recombinant Human PPP3R1, His-tagged | +Inquiry |
PPP3R1-2158H | Recombinant Human PPP3R1 Protein (Met1-Val170), N-His tagged | +Inquiry |
PPP3R1-7366H | Recombinant Human PPP3R1 protein(Gly2-Val170), His-tagged | +Inquiry |
PPP3R1-13269M | Recombinant Mouse PPP3R1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
PPP3R1-001HCL | Recombinant Human PPP3R1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PPP3R1 Products
Required fields are marked with *
My Review for All PPP3R1 Products
Required fields are marked with *
0
Inquiry Basket