Recombinant Human PPP3R1, His-tagged

• Cat.No.: PPP3R1-27208TH
• Product Overview: Recombinant full length Human Calcineurin B with N terminal His tag; 190 amino acids with tag, MWt 21.5 kDa inclusive of tag,

Specification

• Description: PPP3R1, also known as Calcineurin subunit B type 1, is a Ser/Thr-specific calcium and calmodulin-dependent protein phosphatase that plays an essential role in the T cell activation pathway.
• Protein length: 170 amino acids
• Conjugation: HIS
• Molecular Weight: 21.500kDa inclusive of tags
• Source: E. coli
• Form: Liquid
• Purity: >90% by SDS-PAGE
• Storage buffer: Preservative: NoneConstituents: 10% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 2mM DTT, pH 8.0
• Storage: Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
• Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMGNEASYPLEMCSHFDADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQQNPLVQRVIDIFDTDGNGEVDFKEFIEGVSQFSVKGDKEQKLRFAFRIYDMDKDGYISNGELFQVLKMMVGNNLKDTQLQQIVDKTIINADKDGDGRISFEEFCAVVGGLDIHKKMVVDV
• Sequence Similarities: Belongs to the calcineurin regulatory subunit family.Contains 4 EF-hand domains.

Gene Information

• Gene Name: PPP3R1 protein phosphatase 3, regulatory subunit B, alpha [ Homo sapiens ]
• Official Symbol: PPP3R1
• Synonyms: PPP3R1; protein phosphatase 3, regulatory subunit B, alpha; protein phosphatase 3 (formerly 2B), regulatory subunit B (19kD), alpha isoform (calcineurin B, type I) , protein phosphatase 3 (formerly 2B), regulatory subunit B, 19kDa, alpha isoform (calcine
• Gene ID: 5534
• mRNA Refseq: NM_000945
• Protein Refseq: NP_000936
• MIM: 601302
• Uniprot ID: P63098
• Chromosome Location: 2p14
• Pathway: Activation of BAD and translocation to mitochondria, organism-specific biosystem; Activation of BH3-only proteins, organism-specific biosystem; Alzheimers disease, organism-specific biosystem; Alzheimers disease, conserved biosystem; Amyotrophic lateral sclerosis (ALS), organism-specific biosystem
• Function: calcium ion binding; calcium-dependent protein serine/threonine phosphatase activity; calmodulin binding; phosphoprotein phosphatase activity