Recombinant Human PPP2R5C

• Cat.No.: PPP2R5C-29538TH
• Product Overview: Recombinant fragment corresponding to amino acids 1-100 of Human PPP2R5C with an N terminal proprietary tag; Predicted MWt 36.63 kDa.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 100 amino acids
• Description: The product of this gene belongs to the phosphatase 2A regulatory subunit B family. Protein phosphatase 2A is one of the four major Ser/Thr phosphatases, and it is implicated in the negative control of cell growth and division. It consists of a common heteromeric core enzyme, which is composed of a catalytic subunit and a constant regulatory subunit, that associates with a variety of regulatory subunits. The B regulatory subunit might modulate substrate selectivity and catalytic activity. This gene encodes a gamma isoform of the regulatory subunit B56 subfamily. Alternatively spliced transcript variants encoding different isoforms have been identified.
• Molecular Weight: 36.630kDa inclusive of tags
• Tissue specificity: Highest levels in heart, skeletal muscle and brain. Lower levels in pancreas, kidney, lung and placenta. Very low levels in liver.
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: MLTCNKAGSRMVVDAANSNGPFQPVVLLHIRDVPPADQEKLFIQKLRQCCVLFDFVSDPLSDLKWKEVKRAALSEMVEYITHNRNVITEPIYPEVVHMFA
• Sequence Similarities: Belongs to the phosphatase 2A regulatory subunit B56 family.

Gene Information

• Gene Name: PPP2R5C protein phosphatase 2, regulatory subunit B, gamma [ Homo sapiens ]
• Official Symbol: PPP2R5C
• Synonyms: PPP2R5C; protein phosphatase 2, regulatory subunit B, gamma; protein phosphatase 2, regulatory subunit B (B56), gamma isoform , protein phosphatase 2, regulatory subunit B, gamma isoform; serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit
• Gene ID: 5527
• mRNA Refseq: NM_001161725
• Protein Refseq: NP_001155197
• MIM: 601645
• Uniprot ID: Q13362
• Chromosome Location: 14q32.31
• Pathway: Adaptive Immune System, organism-specific biosystem; Beta-catenin phosphorylation cascade, organism-specific biosystem; CTLA4 inhibitory signaling, organism-specific biosystem; Cell Cycle, Mitotic, organism-specific biosystem; Costimulation by the CD28 family, organism-specific biosystem
• Function: binding; peptidase activity; protein binding; protein phosphatase type 2A regulator activity; protein phosphatase type 2A regulator activity