Recombinant Human PPP2R2C

• Cat.No.: PPP2R2C-27932TH
• Product Overview: Recombinant fragment of Human PPP2R2C with an N terminal proprietary tag; Predicted MW 37.73kDa.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 110 amino acids
• Description: The product of this gene belongs to the phosphatase 2 regulatory subunit B family. Protein phosphatase 2 is one of the four major Ser/Thr phosphatases, and it is implicated in the negative control of cell growth and division. It consists of a common heteromeric core enzyme, which is composed of a catalytic subunit and a constant regulatory subunit, that associates with a variety of regulatory subunits. The B regulatory subunit might modulate substrate selectivity and catalytic activity. This gene encodes a gamma isoform of the regulatory subunit B55 subfamily. Alternatively spliced transcript variants encoding different isoforms have been identified.
• Molecular Weight: 37.730kDa inclusive of tags
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: MGEDTDTRKINHSFLRDHSYVTEADIISTVEFNHTGELLA TGDKGGRVVIFQREPESKNAPHSQGEYDVYSTFQSHEPEF DYLKSLEIEEKINKIKWLPQQNAAHSLLST
• Sequence Similarities: Belongs to the phosphatase 2A regulatory subunit B family.Contains 7 WD repeats.

Gene Information

• Gene Name: PPP2R2C protein phosphatase 2, regulatory subunit B, gamma [ Homo sapiens ]
• Official Symbol: PPP2R2C
• Synonyms: PPP2R2C; protein phosphatase 2, regulatory subunit B, gamma; protein phosphatase 2 (formerly 2A), regulatory subunit B (PR 52), gamma isoform , protein phosphatase 2 (formerly 2A), regulatory subunit B, gamma isoform; IMYPNO; MGC33570; PP2A subunit B iso
• Gene ID: 5522
• mRNA Refseq: NM_001206994
• Protein Refseq: NP_001193923
• MIM: 605997
• Uniprot ID: Q9Y2T4
• Chromosome Location: 4p16.1
• Pathway: Chagas disease (American trypanosomiasis), organism-specific biosystem; Chagas disease (American trypanosomiasis), conserved biosystem; Dopaminergic synapse, organism-specific biosystem; Dopaminergic synapse, conserved biosystem; Glycogen Metabolism, organism-specific biosystem
• Function: protein phosphatase type 2A regulator activity