Recombinant Human PPP2CA protein, GST-tagged

Cat.No. : PPP2CA-27617TH
Product Overview : Recombinant Human PPP2CA(1 a.a. - 309 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Protein Length : 1-309 a.a.
Description : This gene encodes the phosphatase 2A catalytic subunit. Protein phosphatase 2A is one of the four major Ser/Thr phosphatases, and it is implicated in the negative control of cell growth and division. It consists of a common heteromeric core enzyme, which is composed of a catalytic subunit and a constant regulatory subunit, that associates with a variety of regulatory subunits. This gene encodes an alpha isoform of the catalytic subunit.
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 62 kDa
AA Sequence : MDEKVFTKELDQWIEQLNECKQLSESQVKSLCEKAKEILTKESNVQEVRCPVTVCGDVHGQFHDLMELFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYRERITILRGNHESRQITQVYGFYDECLRKYGNANVWKYFTDLFDYLPLTALVDGQIFCLHGGLSPSIDTLDHIRALDRLQEVPHEGPMCDLLWSDPDDRGGWGISPRGAGYTFGQDISETFNHANGLTLVSRAHQLVMEGYNWCHDRNVVTIFSAPNYCYRCGNQAAIMELDDTLKYSFLQFDPAPRRGEPHVTRRTPDYFL
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name PPP2CA protein phosphatase 2, catalytic subunit, alpha isozyme [ Homo sapiens ]
Official Symbol PPP2CA
Synonyms PPP2CA; protein phosphatase 2, catalytic subunit, alpha isozyme; protein phosphatase 2 (formerly 2A), catalytic subunit, alpha isoform; serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform; PP2Calpha; protein phosphatase 2A catalytic subunit; alpha isoform; PP2A-alpha; replication protein C; protein phosphatase 2A catalytic subunit, alpha isoform; serine/threonine protein phosphatase 2A, catalytic subunit, alpha isoform; RP-C; PP2Ac; PP2CA;
Gene ID 5515
mRNA Refseq NM_002715
Protein Refseq NP_002706
MIM 176915
UniProt ID P67775
Chromosome Location 5q31.1
Pathway Activated TLR4 signalling, organism-specific biosystem; Adaptive Immune System, organism-specific biosystem; Beta-catenin phosphorylation cascade, organism-specific biosystem; C-MYC pathway, organism-specific biosystem; CTLA4 inhibitory signaling, organism-specific biosystem; Canonical Wnt signaling pathway, organism-specific biosystem; Cell Cycle, organism-specific biosystem;
Function hydrolase activity; metal ion binding; phosphoprotein phosphatase activity; protein C-terminus binding; protein binding; protein dimerization activity;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All PPP2CA Products

Required fields are marked with *

My Review for All PPP2CA Products

Required fields are marked with *

0

Inquiry Basket

cartIcon