Recombinant Human PPP1R9B Protein, His tagged

Cat.No. : PPP1R9B-001H
Product Overview : Recombinant Human PPP1R9B Protein with His tag was expressed in E. coli.
Availability April 16, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 289-412 aa
Description : This gene encodes a scaffold protein that functions as a regulatory subunit of protein phosphatase 1a. Expression of this gene is particularly high in dendritic spines, suggesting that the encoded protein may play a role in receiving signals from the central nervous system. The encoded protein has putative tumor suppressor function and decreased expression has been observed in tumors.
Tag : C-His
Molecular Mass : 14 kDa
AA Sequence : MPPKPREVRKIKPVEVEESGESEAESAPGEVIQAEVTVHAALENGSTVATAASPAPEEPKAQAAPEKEAAAVAPPERGVGNGRAPDVAPEEVDESKKEDFSEADLVDVSAYSGLGEDSAGSALEEHHHHHHHH
Endotoxin : < 1 EU/μg by LAL
Purity : > 80% by SDS-PAGE
Storage : Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Storage Buffer : Sterile PBS, pH7.4
Concentration : 1 mg/mL by BCA
Gene Name PPP1R9B protein phosphatase 1 regulatory subunit 9B [ Homo sapiens (human) ]
Official Symbol PPP1R9B
Synonyms PPP1R9B; protein phosphatase 1 regulatory subunit 9B; Spn; SPINO; PPP1R6; PPP1R9; neurabin-2; neurabin-II; protein phosphatase 1, regulatory (inhibitor) subunit 9B; protein phosphatase 1, regulatory subunit 9B, spinophilin
Gene ID 84687
mRNA Refseq NM_032595
Protein Refseq NP_115984
MIM 603325
UniProt ID Q96SB3

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All PPP1R9B Products

Required fields are marked with *

My Review for All PPP1R9B Products

Required fields are marked with *

0

Inquiry Basket

cartIcon