Recombinant Human PPP1R9B Protein, His tagged

• Cat.No.: PPP1R9B-001H
• Product Overview: Recombinant Human PPP1R9B Protein with His tag was expressed in E. coli.

Specification

• Description: This gene encodes a scaffold protein that functions as a regulatory subunit of protein phosphatase 1a. Expression of this gene is particularly high in dendritic spines, suggesting that the encoded protein may play a role in receiving signals from the central nervous system. The encoded protein has putative tumor suppressor function and decreased expression has been observed in tumors.
• Source: E. coli
• Species: Human
• Tag: C-His
• Protein length: 289-412 aa
• Molecular Mass: 14 kDa
• AA Sequence: MPPKPREVRKIKPVEVEESGESEAESAPGEVIQAEVTVHAALENGSTVATAASPAPEEPKAQAAPEKEAAAVAPPERGVGNGRAPDVAPEEVDESKKEDFSEADLVDVSAYSGLGEDSAGSALEEHHHHHHHH
• Endotoxin: < 1 EU/μg by LAL
• Purity: > 80% by SDS-PAGE
• Storage: Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Storage Buffer: Sterile PBS, pH7.4
• Concentration: 1 mg/mL by BCA

Gene Information

• Gene Name: PPP1R9B protein phosphatase 1 regulatory subunit 9B [ Homo sapiens (human) ]
• Official Symbol: PPP1R9B
• Synonyms: PPP1R9B; protein phosphatase 1 regulatory subunit 9B; Spn; SPINO; PPP1R6; PPP1R9; neurabin-2; neurabin-II; protein phosphatase 1, regulatory (inhibitor) subunit 9B; protein phosphatase 1, regulatory subunit 9B, spinophilin
• Gene ID: 84687
• mRNA Refseq: NM_032595
• Protein Refseq: NP_115984
• MIM: 603325
• UniProt ID: Q96SB3