Recombinant Human PPP1R3G protein, His&Myc-tagged

• Cat.No.: PPP1R3G-4533H
• Product Overview: Recombinant Human PPP1R3G protein(B7ZBB8)(1-358aa), fused with N-terminal His tag and C-terminal Myc tag, was expressed in E.coli.

Specification

• Source: E.coli
• Species: Human
• Tag: N-His&C-Myc
• Protein length: 1-358aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 45.5 kDa
• AASequence: MEPIGARLSLEAPGPAPFREAPPAEELPAPVVPCVQGGGDGGGASETPSPDAQLGDRPLSPKEEAAPQEQEELLECRRRCRARSFSLPADPILQAAKFLQQQQQQAVALGGEGAEDAQLGPGGCCAKCKKRVQFADTLGLSLASVKHFSEAEEPQVPPAVLSRLRSFPMRAEDLEQLGGLLAAAAVAAPLSAPPSRLRPLFQLPGPSAAAERLQRQRVCLERVQCSTASGAEVKGSGRVLSCPGPRAVTVRYTFTEWRSFLDVPAELQPEPLEPQQPEAPSGASEPGSGDAKKEPGAECFHFSLCLPPGLQPEDEEDADERGVAVHFAVCYRCAQGEYWDNNAGANYTLRYARPADAL
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.

Gene Information

• Gene Name: PPP1R3G protein phosphatase 1, regulatory subunit 3G [ Homo sapiens ]
• Official Symbol: PPP1R3G
• Synonyms: PPP1R3G; protein phosphatase 1, regulatory subunit 3G; protein phosphatase 1, regulatory (inhibitor) subunit 3G; putative protein phosphatase 1 regulatory inhibitor subunit 3G
• Gene ID: 648791
• mRNA Refseq: NM_001145115
• Protein Refseq: NP_001138587
• UniProt ID: B7ZBB8