Recombinant Human PPP1R2
Cat.No. : | PPP1R2-29472TH |
Product Overview : | Recombinant full length Human Protein phosphatase 1 inhibitor subunit 2 (amino acids 1-205) with N terminal proprietary tag; Predicted MWt 48.62 kDa inclusive of tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
ProteinLength : | 205 amino acids |
Description : | Protein phosphatase inhibitor 2 is an enzyme that in humans is encoded by the PPP1R2 gene. |
Molecular Weight : | 48.620kDa inclusive of tags |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MAASTASHRPIKGILKNKTSTTSSMVASAEQPRGNVDEEL SKKSQKWDEMNILATYHPADKDYGLMKIDEPSTPYHSMMG DDEDACSDTEATEAMAPDILARKLAAAEGLEPKYRIQEQE SSGEEDSDLSPEEREKKRQFEMKRKLHYNEGLNIKLARQL ISKDLHDDDEDEEMLETADGESMNTEESNQGSTPSDQQQN KLRSS |
Sequence Similarities : | Belongs to the protein phosphatase inhibitor 2 family. |
Gene Name | PPP1R2 protein phosphatase 1, regulatory (inhibitor) subunit 2 [ Homo sapiens ] |
Official Symbol | PPP1R2 |
Synonyms | PPP1R2; protein phosphatase 1, regulatory (inhibitor) subunit 2; protein phosphatase inhibitor 2; IPP2; |
Gene ID | 5504 |
mRNA Refseq | NM_006241 |
Protein Refseq | NP_006232 |
MIM | 601792 |
Uniprot ID | P41236 |
Chromosome Location | 3q29 |
Function | protein binding; protein serine/threonine phosphatase inhibitor activity; |
◆ Recombinant Proteins | ||
CCN5-776HFL | Recombinant Full Length Human CCN5 Protein, C-Flag-tagged | +Inquiry |
RFL34585OF | Recombinant Full Length Oryza Sativa Subsp. Japonica Metal Tolerance Protein 6(Mtp6) Protein, His-Tagged | +Inquiry |
MMRN2-2452H | Recombinant Human MMRN2 Protein, His-tagged | +Inquiry |
PITPNA-12843M | Recombinant Mouse PITPNA Protein | +Inquiry |
Stam-7147M | Recombinant Mouse Stam protein, His & T7-tagged | +Inquiry |
◆ Native Proteins | ||
Collagen Type I & III-07P | Native Porcine Collagen Type I and III Protein | +Inquiry |
BPE-138 | Native Red algae B-Phycoerythrin protein | +Inquiry |
CAPN1-8448H | Active Native Human CAPN1 | +Inquiry |
IgG-020S | Native Sheep Whole Molecule IgG, Biotin-LC-NHS Conjugated | +Inquiry |
TF-136C | Native Chicken Ovotransferrin | +Inquiry |
◆ Cell & Tissue Lysates | ||
POLRMT-3019HCL | Recombinant Human POLRMT 293 Cell Lysate | +Inquiry |
ADAMTSL5-8HCL | Recombinant Human ADAMTSL5 lysate | +Inquiry |
CFH-2409HCL | Recombinant Human CFH cell lysate | +Inquiry |
PDF-3338HCL | Recombinant Human PDF 293 Cell Lysate | +Inquiry |
BAIAP2L1-8520HCL | Recombinant Human BAIAP2L1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PPP1R2 Products
Required fields are marked with *
My Review for All PPP1R2 Products
Required fields are marked with *
0
Inquiry Basket