Recombinant Human PPP1R14D protein, His-tagged

• Cat.No.: PPP1R14D-294H
• Product Overview: Recombinant Human PPP1R14D protein(NP_001123615)(1-145 aa), fused to His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 1-145 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• AA Sequence: MLSSSPASCTSPSPDGENPCKKVHWASGRRRTSSTDSESKSHPDSSKIPRSRRPSRLTVKYDRGQLQRWLEMEQWVDAQVQELFQDQATPSEPEIDLEALMDLSTEEQKTQLEAILGNCPRPTEAFISELLSQLKKLRRLSRPQK
• Purity: 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Aliquot and store at -20°C to -80°C for up to 6 months. Avoid repeat freeze-thaw cycles.
• Concentration: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: PPP1R14D protein phosphatase 1, regulatory (inhibitor) subunit 14D [ Homo sapiens ]
• Official Symbol: PPP1R14D
• Synonyms: PPP1R14D; protein phosphatase 1, regulatory (inhibitor) subunit 14D; protein phosphatase 1 regulatory subunit 14D; CPI17 like; FLJ20251; GBPI 1; gut and brain phosphatase inhibitor 1; MGC119014; MGC119016; PKC dependent PP1 inhibitory protein; PKC-dependent PP1 inhibitory protein; gastrointestinal and brain-specific PP1-inhibitory protein 1; GBPI1; GBPI-1; CPI17-like
• Gene ID: 54866
• mRNA Refseq: NM_001130143
• Protein Refseq: NP_001123615
• MIM: 613256
• UniProt ID: Q9NXH3