Recombinant Human PPM1B protein, His-SUMO-tagged
Cat.No. : | PPM1B-3365H |
Product Overview : | Recombinant Human PPM1B protein(O75688)(2-192aa), fused to N-terminal His-SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 2-192aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 36.6 kDa |
AA Sequence : | SIVLVCFSNAPKVSDEAVKKDSELDKHLESRVEEIMEKSGEEGMPDLAHVMRILSAENIPNLPPGGGLAGKRNVIEAVYSRLNPHRESDGASDEAEESGSQGKLVEALRQMRINHRGNYRQLLEEMLTSYRLAKVEGEESPAEPAATATSSNSDAGNPVTMQESHTESESGLAELDSSNEDAGTKMSGEKI |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | PPM1B protein phosphatase, Mg2+/Mn2+ dependent, 1B [ Homo sapiens ] |
Official Symbol | PPM1B |
Synonyms | PPM1B; protein phosphatase, Mg2+/Mn2+ dependent, 1B; protein phosphatase 1B (formerly 2C), magnesium dependent, beta isoform; protein phosphatase 1B; PP2CB; PP2CBETA; PPC2BETAX; protein phosphatase 2C; beta isoform; PP2C-beta; protein phosphatase 2C isoform beta; protein phosphatase 2C-like protein; protein phosphatase 1B (formerly 2C), magnesium-dependent, beta isoform; PP2C-beta-X; MGC21657; |
Gene ID | 5495 |
mRNA Refseq | NM_001033556 |
Protein Refseq | NP_001028728 |
MIM | 603770 |
UniProt ID | O75688 |
◆ Recombinant Proteins | ||
PPM1B-3370R | Recombinant Rhesus Macaque PPM1B Protein, His (Fc)-Avi-tagged | +Inquiry |
PPM1B-3552R | Recombinant Rhesus monkey PPM1B Protein, His-tagged | +Inquiry |
PPM1B-79H | Recombinant Human PPM1B protein, His-tagged | +Inquiry |
PPM1B-3365H | Recombinant Human PPM1B protein, His-SUMO-tagged | +Inquiry |
PPM1B-508H | Recombinant Human PPM1B Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
PPM1B-2962HCL | Recombinant Human PPM1B 293 Cell Lysate | +Inquiry |
PPM1B-2963HCL | Recombinant Human PPM1B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PPM1B Products
Required fields are marked with *
My Review for All PPM1B Products
Required fields are marked with *
0
Inquiry Basket