Recombinant Human PPM1B protein, His-SUMO-tagged

• Cat.No.: PPM1B-3365H
• Product Overview: Recombinant Human PPM1B protein(O75688)(2-192aa), fused to N-terminal His-SUMO tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: His&SUMO
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 36.6 kDa
• Protein length: 2-192aa
• AA Sequence: SIVLVCFSNAPKVSDEAVKKDSELDKHLESRVEEIMEKSGEEGMPDLAHVMRILSAENIPNLPPGGGLAGKRNVIEAVYSRLNPHRESDGASDEAEESGSQGKLVEALRQMRINHRGNYRQLLEEMLTSYRLAKVEGEESPAEPAATATSSNSDAGNPVTMQESHTESESGLAELDSSNEDAGTKMSGEKI
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: PPM1B protein phosphatase, Mg2+/Mn2+ dependent, 1B [ Homo sapiens ]
• Official Symbol: PPM1B
• Synonyms: PPM1B; protein phosphatase, Mg2+/Mn2+ dependent, 1B; protein phosphatase 1B (formerly 2C), magnesium dependent, beta isoform; protein phosphatase 1B; PP2CB; PP2CBETA; PPC2BETAX; protein phosphatase 2C; beta isoform; PP2C-beta; protein phosphatase 2C isoform beta; protein phosphatase 2C-like protein; protein phosphatase 1B (formerly 2C), magnesium-dependent, beta isoform; PP2C-beta-X; MGC21657
• Gene ID: 5495
• mRNA Refseq: NM_001033556
• Protein Refseq: NP_001028728
• MIM: 603770
• UniProt ID: O75688