Recombinant Human PPIF protein

• Cat.No.: PPIF-543H
• Product Overview: Recombinant Human PPIF protein was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: Non
• Protein Length: 178
• Description: CyP-D is a part of the peptidyl-prolyl cis-trans isomerase (PPIase) family. CyP-D accelerates the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides. CyP-D is key component of the mitochondrial permeability transition pore in the inner mitochondrial membrane. Activation of this pore is thought to be involved in the induction of apoptotic and necrotic cell death.
• Form: Supplied as a 0.2 μm filtered solution in PBS, pH7.4, with 1 mM DTT, 10 % glycerol.
• Molecular Mass: Approximately 18.9 kDa, a single non-glycosylated polypeptide chain containing 178 amino acids.
• AA Sequence: CSKGSGDPSSSSSSGNPLVYLDVDANGKPLGRVVLELKADVVPKTAENFRALCTGEKGFGYKGSTFHRVIPSFMCQAGDFTNHNGTGGKSIYGSRFPDENFTLKHVGPGVLSMANAGPNTNGSQFFICTIKTDWLDGKHVVFGHVKEGMDVVKKIESFGSKSGRTSKKIVITDCGQLS
• Endotoxin: Less than 0.1 EU/μg of rHuCyP-D as determined by LAL method.
• Purity: >95% by SDS-PAGE and HPLC analyses.
• Storage: Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 6 months from date of receipt, -20 to -70 centigrade as supplied. 3 months, -20 to -70 centigrade under sterile conditions after opening.

Gene Information

• Gene Name: PPIF
• Official Symbol: PPIF
• Synonyms: PPIF; peptidylprolyl isomerase F; peptidylprolyl isomerase F (cyclophilin F); peptidyl-prolyl cis-trans isomerase F, mitochondrial; cyclophilin D; Cyp D; hCyP3; PPIase F; rotamase F; cyclophilin 3; cyclophilin F; peptidyl-prolyl cis-trans isomerase, mitochondrial; CYP3; Cyp-D; FLJ90798; MGC117207
• Gene ID: 10105
• mRNA Refseq: NM_005729
• Protein Refseq: NP_005720
• MIM: 604486
• UniProt ID: P30405