Recombinant Human PPHLN1, His-tagged

Cat.No. : PPHLN1-28673TH
Product Overview : Recombinant fragment, corresponding to amino acids 68-293 of Human PPHLN1 isoform 8, with N terminal His tag; 226 amino acids, 33kDa (26kDa predicted from sequence). Gene ID = 51535
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 68-293 a.a.
Description : The protein encoded by this gene is one of the several proteins that become sequentially incorporated into the cornified cell envelope during the terminal differentiation of keratinocyte at the outer layers of epidermis. This protein interacts with periplakin, which is known as a precursor of the cornified cell envelope. The cellular localization pattern and insolubility of this protein suggest that it may play a role in epithelial differentiation and contribute to epidermal integrity and barrier formation. Multiple alternatively spliced transcript variants encoding distinct isoforms have been observed.
Conjugation : HIS
Tissue specificity : Ubiquitous.
Form : Liquid
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : YKRDNTFFRESPVGRKDSPHSRSGSSVSSRSYSPERSKSY SFHQSQHRNKERPVQSLKTSRDTSPSSGSAVSSSKVLD KPSRLTEKELAEAASKWAAEKLEKSDESNLPEISEYEA GSTAPLFTDQPEEPESNTTHGIELFEDSQLTTRSKAIA SKTKEIEQVYRQDCETFGMVVKMLIEKDPSLEKSIQFALRQNLHEIGERCVEELKHFIAEYDTSTQDFGEPF
Gene Name PPHLN1 periphilin 1 [ Homo sapiens ]
Official Symbol PPHLN1
Synonyms PPHLN1; periphilin 1; periphilin-1;
Gene ID 51535
mRNA Refseq NM_201515
Protein Refseq NP_958923
MIM 608150
Uniprot ID Q8NEY8
Chromosome Location 12q12

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All PPHLN1 Products

Required fields are marked with *

My Review for All PPHLN1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon