Recombinant Human PPHLN1, His-tagged
Cat.No. : | PPHLN1-28673TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 68-293 of Human PPHLN1 isoform 8, with N terminal His tag; 226 amino acids, 33kDa (26kDa predicted from sequence). Gene ID = 51535 |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 68-293 a.a. |
Description : | The protein encoded by this gene is one of the several proteins that become sequentially incorporated into the cornified cell envelope during the terminal differentiation of keratinocyte at the outer layers of epidermis. This protein interacts with periplakin, which is known as a precursor of the cornified cell envelope. The cellular localization pattern and insolubility of this protein suggest that it may play a role in epithelial differentiation and contribute to epidermal integrity and barrier formation. Multiple alternatively spliced transcript variants encoding distinct isoforms have been observed. |
Conjugation : | HIS |
Tissue specificity : | Ubiquitous. |
Form : | Liquid |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | YKRDNTFFRESPVGRKDSPHSRSGSSVSSRSYSPERSKSY SFHQSQHRNKERPVQSLKTSRDTSPSSGSAVSSSKVLD KPSRLTEKELAEAASKWAAEKLEKSDESNLPEISEYEA GSTAPLFTDQPEEPESNTTHGIELFEDSQLTTRSKAIA SKTKEIEQVYRQDCETFGMVVKMLIEKDPSLEKSIQFALRQNLHEIGERCVEELKHFIAEYDTSTQDFGEPF |
Gene Name | PPHLN1 periphilin 1 [ Homo sapiens ] |
Official Symbol | PPHLN1 |
Synonyms | PPHLN1; periphilin 1; periphilin-1; |
Gene ID | 51535 |
mRNA Refseq | NM_201515 |
Protein Refseq | NP_958923 |
MIM | 608150 |
Uniprot ID | Q8NEY8 |
Chromosome Location | 12q12 |
◆ Recombinant Proteins | ||
PPHLN1-961H | Recombinant Human PPHLN1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
PPHLN1-28673TH | Recombinant Human PPHLN1, His-tagged | +Inquiry |
Pphln1-8036M | Recombinant Mouse Pphln1 protein, His & T7-tagged | +Inquiry |
Pphln1-5037M | Recombinant Mouse Pphln1 Protein, Myc/DDK-tagged | +Inquiry |
PPHLN1-2438C | Recombinant Chicken PPHLN1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
PPHLN1-2976HCL | Recombinant Human PPHLN1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PPHLN1 Products
Required fields are marked with *
My Review for All PPHLN1 Products
Required fields are marked with *
0
Inquiry Basket