Recombinant Human PPBP Protein
Cat.No. : | PPBP-227H |
Product Overview : | Recombinant Human PPBP Protein without tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Description : | Neutrophil activating peptide 2 (NAP-2), also known as CXCL7, is a member of the CXC family of chemokines. NAP-2 is a carboxyl-terminal fragment produced by proteolytic cleavage of the platelet basic protein (PBP). NAP-2 is released from platelets and binds to the receptors CXCR1 and CXCR2 to chemoattract and activate neutrophils during inflammatory events. |
Bio-activity : | No biological activity data is available at this time. |
Molecular Mass : | Monomer, 7.6 kDa (70 amino acids) |
AA Sequence : | AELRCMCIKTTSGIHPKNIQSLEVIGKGTHCNQVEVIATLKDGRKICLDPDAPRIKKIVQKKLAGDESAD |
Endotoxin : | ≤1 EUs/μg, Kinetic LAL (50% confidence) |
Purity : | ≥95%, Reducing and Non-Reducing SDS PAGE |
Stability : | 12 months from date of receipt when stored at -20 to -80 centigrade as supplied. 1 month when stored at 4 centigrade after reconstituting as directed. 3 months when stored at -20 to -80 centigrade after reconstituting as directed. |
Storage : | Storage Prior to Reconstitution: -20 centigrade |
Storage Buffer : | Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 10 mM sodium phosphate, pH 7.5 |
Reconstitution : | Sterile water at 0.1 mg/mL |
Shipping : | Room temperature |
Instructions : | Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 centigrade and avoid repeat freeze thaws. |
Gene Name | PPBP pro-platelet basic protein (chemokine (C-X-C motif) ligand 7) [ Homo sapiens (human) ] |
Official Symbol | PPBP |
Synonyms | PPBP; pro-platelet basic protein (chemokine (C-X-C motif) ligand 7); THBGB1; platelet basic protein; b TG1; Beta TG; beta thromboglobulin; connective tissue activating peptide III; CTAP3; CTAPIII; CXCL7; LA PF4; LDGF; MDGF; NAP 2; NAP 2 L1; neutrophil activating peptide 2; PBP; SCYB7; TGB; TGB1; thrombocidin 1; thrombocidin 2; beta-thromboglobulin; CXC chemokine ligand 7; C-X-C motif chemokine 7; thromboglobulin, beta-1; small inducible cytokine B7; small-inducible cytokine B7; leukocyte-derived growth factor; low-affinity platelet factor IV; neutrophil-activating peptide 2; neutrophil-activating peptide-2; macrophage-derived growth factor; connective tissue-activating peptide III; small inducible cytokine subfamily B, member 7; TC1; TC2; B-TG1; NAP-2; THBGB; LA-PF4; SCAR10; Beta-TG; CTAP-III; |
Gene ID | 5473 |
mRNA Refseq | NM_002704 |
Protein Refseq | NP_002695 |
MIM | 121010 |
UniProt ID | P02775 |
◆ Recombinant Proteins | ||
PPBP-2601H | Recombinant Full Length Human PPBP Protein, MYC/DDK-tagged | +Inquiry |
Ppbp-5457M | Recombinant Mouse Ppbp Protein (Ile48-Ile109), N-His tagged | +Inquiry |
Ppbp-2162M | Recombinant Mouse Ppbp protein, His-tagged | +Inquiry |
PPBP-1073R | Recombinant Rat PPBP Protein, Fc-tagged | +Inquiry |
PPBP-385HF | Recombinant Full Length Human PPBP Protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
PPBP-30279TH | Native Human PPBP | +Inquiry |
◆ Cell & Tissue Lysates | ||
PPBP-1616RCL | Recombinant Rat PPBP cell lysate | +Inquiry |
PPBP-1397CCL | Recombinant Cynomolgus PPBP cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PPBP Products
Required fields are marked with *
My Review for All PPBP Products
Required fields are marked with *
0
Inquiry Basket