Recombinant Human PPARA protein, His&Myc-tagged

Cat.No. : PPARA-2251H
Product Overview : Recombinant Human PPARA protein(Q07869)(1-468aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in Insect Cell.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Insect Cells
Tag : His&Myc
Protein Length : 1-468aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 56.2 kDa
AA Sequence : MVDTESPLCPLSPLEAGDLESPLSEEFLQEMGNIQEISQSIGEDSSGSFGFTEYQYLGSCPGSDGSVITDTLSPASSPSSVTYPVVPGSVDESPSGALNIECRICGDKASGYHYGVHACEGCKGFFRRTIRLKLVYDKCDRSCKIQKKNRNKCQYCRFHKCLSVGMSHNAIRFGRMPRSEKAKLKAEILTCEHDIEDSETADLKSLAKRIYEAYLKNFNMNKVKARVILSGKASNNPPFVIHDMETLCMAEKTLVAKLVANGIQNKEAEVRIFHCCQCTSVETVTELTEFAKAIPGFANLDLNDQVTLLKYGVYEAIFAMLSSVMNKDGMLVAYGNGFITREFLKSLRKPFCDIMEPKFDFAMKFNALELDDSDISLFVAAIICCGDRPGLLNVGHIEKMQEGIVHVLRLHLQSNHPDDIFLFPKLLQKMADLRQLVTEHAQLVQIIKKTESDAALHPLLQEIYRDMY
Purity : Greater than 85% as determined by SDS-PAGE.
Storage : Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Gene Name PPARA peroxisome proliferator-activated receptor alpha [ Homo sapiens ]
Official Symbol PPARA
Synonyms PPARA; peroxisome proliferator-activated receptor alpha; peroxisome proliferative activated receptor, alpha , PPAR; hPPAR; NR1C1; PPAR-alpha; nuclear receptor subfamily 1 group C member 1; peroxisome proliferative activated receptor, alpha; peroxisome proliferator-activated nuclear receptor alpha variant 3; PPAR; PPARalpha; MGC2237; MGC2452;
Gene ID 5465
mRNA Refseq NM_001001928
Protein Refseq NP_001001928
UniProt ID Q07869

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All PPARA Products

Required fields are marked with *

My Review for All PPARA Products

Required fields are marked with *

0

Inquiry Basket

cartIcon