Recombinant Human POMP Protein, GST-tagged

• Cat.No.: POMP-521H
• Product Overview: Human C13orf12 full-length ORF ( NP_057016.1, 1 a.a. - 141 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 42.2 kDa
• AA Sequence: MNARGLGSELKDSIPVTELSASGPFESHDLLRKGFSCVKNELLPSHPLELSEKNFQLNQDKMNFSTLRNIQGLFAPLKLQMEFKAVQQVQRLPFLSSSNLSLDVLRGNDETIGFEDILNDPSQSEVMGEPHLMVEYKLGLL
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: POMP proteasome maturation protein [ Homo sapiens ]
• Official Symbol: POMP
• Synonyms: POMP; proteasome maturation protein; C13orf12, chromosome 13 open reading frame 12; HSPC014; proteassemblin; UMP1; hUMP1; 2510048O06Rik; protein UMP1 homolog; voltage-gated K channel beta subunit 4.1; voltage-gated potassium channel beta subunit 4.1; C13orf12; PNAS-110
• Gene ID: 51371
• mRNA Refseq: NM_015932
• Protein Refseq: NP_057016
• MIM: 613386
• UniProt ID: Q9Y244